Size:100 ul
$319.00
In stock
SKU
ARP43818_P050
Request Bulk
Order Quote
Aviva's
Satisfaction
Guarantee
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email: info@avivasysbio.com
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Conjugation Options

ARP43818_P050-FITC Conjugated

ARP43818_P050-HRP Conjugated

ARP43818_P050-Biotin Conjugated

More Information
Tested Species ReactivityHuman, Rat
Predicted Species ReactivityCow, Dog, Goat, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep, Zebrafish
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationIHC, WB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Replacement ItemThis antibody may replace item sc-11433 from Santa Cruz Biotechnology.
ImmunogenThe immunogen is a synthetic peptide directed towards the N terminal region of human SLC25A4
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceCow: 100%; Dog: 100%; Goat: 100%; Guinea Pig: 100%; Horse: 93%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Sheep: 100%; Zebrafish: 86%
Complete computational species homology dataAnti-SLC25A4 (ARP43818_P050)
Peptide SequenceSynthetic peptide located within the following region: LLQVQHASKQISAEKQYKGIIDCVVRIPKEQGFLSFWRGNLANVIRYFPT
ConcentrationBatch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking PeptideFor anti-SLC25A4 (ARP43818_P050) antibody is Catalog # AAP43818 (Previous Catalog # AAPS14103)
Datasheets/ManualsPrintable datasheet for anti-SLC25A4 (ARP43818_P050) antibody
Sample Type Confirmation

SLC25A4 is supported by BioGPS gene expression data to be expressed in RPMI 8226

Gene SymbolSLC25A4
Official Gene Full NameSolute carrier family 25 (mitochondrial carrier; adenine nucleotide translocator), member 4
Alias SymbolsANT, ANT1, PEO2, PEO3, T1, AAC1
NCBI Gene Id291
Protein NameADP/ATP translocase 1
Description of TargetThis gene is a member of the mitochondrial carrier subfamily of solute carrier protein genes. The product of this gene functions as a gated pore that translocates ADP from the mitochondrial matrix into the cytoplasm. The protein forms a homodimer embedded in the inner mitochondria membrane. Mutations in this gene have been shown to result in autosomal dominant progressive external opthalmoplegia and familial hypertrophic cardiomyopathy.
Swissprot IdQ05962
Protein Accession #NP_001142
Nucleotide Accession #NM_001151
Protein Size (# AA)298
Molecular Weight33kDa
Tissue ToolFind tissues and cell lines supported by DNA array analysis to express SLC25A4.
RNA SeqFind tissues and cell lines supported by RNA-seq analysis to express SLC25A4.
Protein InteractionsUBC; MDM2; PARK2; CLN5; CLN3; UBL4A; RPLP0P6; RPL10L; UQCRFS1P1; UQCRC1; RPS3A; RPS2; RPSA; GALNT2; UBD; COPS5; CDK2; TCF3; SUMO4; ICT1; NFKBIA; MGMT; PPID; PPIF; BAX; AR; PRKCE; NR3C1;
Write Your Own Review
You're reviewing:SLC25A4 Antibody - N-terminal region (ARP43818_P050)
Your Rating
Aviva Tissue Tool
Aviva ChIP Antibodies
Aviva Pathways
Aviva Live Chat