Search Antibody, Protein, and ELISA Kit Solutions

SLC25A4 Antibody - N-terminal region (ARP43818_P050)

100 ul
In Stock
Request Bulk Order Quote

Conjugation Options

ARP43818_P050-FITC Conjugated

ARP43818_P050-HRP Conjugated

ARP43818_P050-Biotin Conjugated

Tested Species Reactivity:
Human, Rat
Predicted Species Reactivity:
Cow, Dog, Goat, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep, Zebrafish
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Gene Symbol:
Official Gene Full Name:
Solute carrier family 25 (mitochondrial carrier; adenine nucleotide translocator), member 4
NCBI Gene Id:
Protein Name:
ADP/ATP translocase 1
Swissprot Id:
Protein Accession #:
Nucleotide Accession #:
Alias Symbols:
Replacement Item:
This antibody may replace item sc-11433 from Santa Cruz Biotechnology.
Description of Target:
This gene is a member of the mitochondrial carrier subfamily of solute carrier protein genes. The product of this gene functions as a gated pore that translocates ADP from the mitochondrial matrix into the cytoplasm. The protein forms a homodimer embedded in the inner mitochondria membrane. Mutations in this gene have been shown to result in autosomal dominant progressive external opthalmoplegia and familial hypertrophic cardiomyopathy.
Protein Size (# AA):
Molecular Weight:
Affinity Purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express SLC25A4.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express SLC25A4.
The immunogen is a synthetic peptide directed towards the N terminal region of human SLC25A4
Predicted Homology Based on Immunogen Sequence:
Cow: 100%; Dog: 100%; Goat: 100%; Guinea Pig: 100%; Horse: 93%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Sheep: 100%; Zebrafish: 86%
Complete computational species homology data:
Anti-SLC25A4 (ARP43818_P050)
Peptide Sequence:
Synthetic peptide located within the following region: LLQVQHASKQISAEKQYKGIIDCVVRIPKEQGFLSFWRGNLANVIRYFPT
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
Blocking Peptide:
For anti-SLC25A4 (ARP43818_P050) antibody is Catalog # AAP43818 (Previous Catalog # AAPS14103)
Printable datasheet for anti-SLC25A4 (ARP43818_P050) antibody
Sample Type Confirmation:

SLC25A4 is supported by BioGPS gene expression data to be expressed in RPMI 8226

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...