Size:100 ul
In Stock
Request Bulk
Order Quote
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email:
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Conjugation Options

ARP43818_P050-FITC Conjugated

ARP43818_P050-HRP Conjugated

ARP43818_P050-Biotin Conjugated

More Information
Tested Species Reactivity Human, Rat
Predicted Species Reactivity Cow, Dog, Goat, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep, Zebrafish
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clonality Polyclonal
Host Rabbit
Application IHC, WB
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Replacement Item This antibody may replace item sc-11433 from Santa Cruz Biotechnology.
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human SLC25A4
Purification Affinity Purified
Predicted Homology Based on Immunogen Sequence Cow: 100%; Dog: 100%; Goat: 100%; Guinea Pig: 100%; Horse: 93%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Sheep: 100%; Zebrafish: 86%
Complete computational species homology data Anti-SLC25A4 (ARP43818_P050)
Peptide Sequence Synthetic peptide located within the following region: LLQVQHASKQISAEKQYKGIIDCVVRIPKEQGFLSFWRGNLANVIRYFPT
Concentration Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide For anti-SLC25A4 (ARP43818_P050) antibody is Catalog # AAP43818 (Previous Catalog # AAPS14103)
Datasheets/Manuals Printable datasheet for anti-SLC25A4 (ARP43818_P050) antibody
Sample Type Confirmation

SLC25A4 is supported by BioGPS gene expression data to be expressed in RPMI 8226

Gene Symbol SLC25A4
Official Gene Full Name Solute carrier family 25 (mitochondrial carrier; adenine nucleotide translocator), member 4
Alias Symbols ANT, ANT1, PEO2, PEO3, T1, AAC1
NCBI Gene Id 291
Protein Name ADP/ATP translocase 1
Description of Target This gene is a member of the mitochondrial carrier subfamily of solute carrier protein genes. The product of this gene functions as a gated pore that translocates ADP from the mitochondrial matrix into the cytoplasm. The protein forms a homodimer embedded in the inner mitochondria membrane. Mutations in this gene have been shown to result in autosomal dominant progressive external opthalmoplegia and familial hypertrophic cardiomyopathy.
Swissprot Id Q05962
Protein Accession # NP_001142
Nucleotide Accession # NM_001151
Protein Size (# AA) 298
Molecular Weight 33kDa
Tissue Tool Find tissues and cell lines supported by DNA array analysis to express SLC25A4.
RNA Seq Find tissues and cell lines supported by RNA-seq analysis to express SLC25A4.
  1. What is the species homology for "SLC25A4 Antibody - N-terminal region (ARP43818_P050)"?

    The tested species reactivity for this item is "Human, Rat". This antibody is predicted to have homology to "Cow, Dog, Goat, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep, Zebrafish".

  2. How long will it take to receive "SLC25A4 Antibody - N-terminal region (ARP43818_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "SLC25A4 Antibody - N-terminal region (ARP43818_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact

  4. What are other names for "SLC25A4 Antibody - N-terminal region (ARP43818_P050)"?

    This target may also be called "ANT, ANT1, PEO2, PEO3, T1, AAC1" in publications.

  5. What is the shipping cost for "SLC25A4 Antibody - N-terminal region (ARP43818_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "SLC25A4 Antibody - N-terminal region (ARP43818_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "SLC25A4 Antibody - N-terminal region (ARP43818_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "33kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "SLC25A4 Antibody - N-terminal region (ARP43818_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data tab on the product page.

  10. What are positive controls for "SLC25A4"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "SLC25A4"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "SLC25A4"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "SLC25A4"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "SLC25A4"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "SLC25A4"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:SLC25A4 Antibody - N-terminal region (ARP43818_P050)
Your Rating
We found other products you might like!