Search Antibody, Protein, and ELISA Kit Solutions

SLC25A11 Antibody - C-terminal region (ARP43850_P050)

100 ul
In Stock
Request Bulk Order Quote

Conjugation Options

ARP43850_P050-FITC Conjugated

ARP43850_P050-HRP Conjugated

ARP43850_P050-Biotin Conjugated

Tested Species Reactivity:
Predicted Species Reactivity:
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep, Zebrafish
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Gene Symbol:
Official Gene Full Name:
Solute carrier family 25 (mitochondrial carrier; oxoglutarate carrier), member 11
NCBI Gene Id:
Protein Name:
Mitochondrial 2-oxoglutarate/malate carrier protein
Swissprot Id:
Protein Accession #:
Nucleotide Accession #:
Alias Symbols:
Replacement Item:
This antibody may replace item sc-130418 from Santa Cruz Biotechnology.
Description of Target:
SLC25A11 catalyzes the transport of 2-oxoglutarate across the inner mitochondrial membrane in an electroneutral exchange for malate or other dicarboxylic acids, and plays an important role in several metabolic processes, including the malate-aspartate shuttle, the oxoglutarate/isocitrate shuttle, in gluconeogenesis from lactate, and in nitrogen metabolism.
Protein Size (# AA):
Molecular Weight:
Affinity Purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express SLC25A11.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express SLC25A11.
The immunogen is a synthetic peptide directed towards the C terminal region of human SLC25A11
Predicted Homology Based on Immunogen Sequence:
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Sheep: 100%; Zebrafish: 100%
Complete computational species homology data:
Anti-SLC25A11 (ARP43850_P050)
Peptide Sequence:
Synthetic peptide located within the following region: DGKPEYKNGLDVLFKVVRYEGFFSLWKGFTPYYARLGPHTVLTFIFLEQM
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
Blocking Peptide:
For anti-SLC25A11 (ARP43850_P050) antibody is Catalog # AAP43850 (Previous Catalog # AAPS14311)
Printable datasheet for anti-SLC25A11 (ARP43850_P050) antibody
Target Reference:
Kabe,Y., (2006) J. Biol. Chem. 281 (42), 31729-31735

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...