Search Antibody, Protein, and ELISA Kit Solutions

SLC24A6 Antibody - middle region (ARP44042_P050)

Click here to learn more about Aviva's By-Request Conjugation Service.
100 ul
In Stock
Request Bulk Order Quote

Conjugation Options

ARP44042_P050-FITC Conjugated

ARP44042_P050-HRP Conjugated

ARP44042_P050-Biotin Conjugated

Click here to learn more about Aviva's By-Request Conjugation Service.
Tested Species Reactivity:
Predicted Species Reactivity:
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Gene Symbol:
Official Gene Full Name:
Solute carrier family 24 (sodium/lithium/calcium exchanger), member 6
NCBI Gene Id:
Protein Name:
Sodium/potassium/calcium exchanger 6
Swissprot Id:
Protein Accession #:
Nucleotide Accession #:
Alias Symbols:
FLJ22233, NCKX6, NCLX, SLC24A6
Description of Target:
SLC24A6 belongs to a family of potassium-dependent sodium/calcium exchangers that maintain cellular calcium homeostasis through the electrogenic countertransport of 4 sodium ions for 1 calcium ion and 1 potassium ion.SLC24A6 belongs to a family of potassium-dependent sodium/calcium exchangers that maintain cellular calcium homeostasis through the electrogenic countertransport of 4 sodium ions for 1 calcium ion and 1 potassium ion (Cai and Lytton, 2004 [PubMed 14625281]).[supplied by OMIM].
Protein Size (# AA):
Molecular Weight:
Affinity Purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express SLC24A6.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express SLC24A6.
The immunogen is a synthetic peptide directed towards the middle region of human SLC24A6
Predicted Homology Based on Immunogen Sequence:
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%
Complete computational species homology data:
Anti-SLC24A6 (ARP44042_P050)
Peptide Sequence:
Synthetic peptide located within the following region: SIGDAFSDFTLARQGYPRMAFSACFGGIIFNILVGVGLGCLLQISRSHTE
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
Blocking Peptide:
For anti-SLC8B1 (ARP44042_P050) antibody is Catalog # AAP44042 (Previous Catalog # AAPP11783)
Printable datasheet for anti-SLC8B1 (ARP44042_P050) antibody
Target Reference:
Palty,R., (2004) J. Biol. Chem. 279 (24), 25234-25240

Product Reviews

Average Rating:
1 review
5 star
4 star
3 star
2 star
1 star
  • Date - Newest First
  • Date - Newest First
  • Date - Latest First
  • Highest Rated
  • Lowest Rated
  • Most Helpful
  • Ownership

1 Item(s)

78/03/2019 02:59
  • Overall Experience:
  • Quality:
HEK293 cells, primary mouse hippocampal cells in WB

Submitted by:
University of Heidelberg, Germany


Sample type/lane description: HEK293 cells, primary mouse hippocampal cells.

Show more comments (-2) Hide comments

1 Item(s)

What kind of abuse are you reporting?
    Please, wait...