Catalog No: ARP63404_P050
Price: $0.00
SKU
ARP63404_P050
Availability: Domestic: within 1-2 days delivery | International: 1-2 days
Bulk
Order
Aviva's
Satisfaction
Guarantee
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.
Datasheets/ManualsPrintable datasheet for anti-SLC22A5 (ARP63404_P050) antibody
Product Info
Publications

Downregulation of duodenal SLC transporters and activation of proinflammatory signaling constitute the early response to high altitude in humans. Am J Physiol Gastrointest Liver Physiol. 307, G673-88 (2014). 24970780

More...

Tested Species ReactivityHuman
Predicted Species ReactivityHuman, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Rabbit
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationWB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceCow: 100%; Dog: 85%; Guinea Pig: 92%; Horse: 100%; Human: 100%; Pig: 100%; Rabbit: 92%; Rat: 92%
Peptide SequenceSynthetic peptide located within the following region: GIVVPSTIFDPSELQDLSSKKQQSHNILDLLRTWNIRMVTIMSIMLWMTI
Concentration0.5 mg/ml
Blocking PeptideFor anti-SLC22A5 (ARP63404_P050) antibody is Catalog # AAP63404
Gene SymbolSLC22A5
Gene Full NameSolute carrier family 22 (organic cation/carnitine transporter), member 5
Alias SymbolsCDSP, OCTN2
NCBI Gene Id6584
Protein NameSolute carrier family 22 member 5
Description of TargetPolyspecific organic cation transporters in the liver, kidney, intestine, and other organs are critical for elimination of many endogenous small organic cations as well as a wide array of drugs and environmental toxins. The encoded protein is a plasma integral membrane protein which functions both as an organic cation transporter and as a sodium-dependent high affinity carnitine transporter. The encoded protein is involved in the active cellular uptake of carnitine. Mutations in this gene are the cause of systemic primary carnitine deficiency (CDSP), an autosomal recessive disorder manifested early in life by hypoketotic hypoglycemia and acute metabolic decompensation, and later in life by skeletal myopathy or cardiomyopathy.
Uniprot IDO76082
Protein Accession #NP_003051
Nucleotide Accession #NM_003060
Protein Size (# AA)557
Molecular Weight61kDa
Protein InteractionsUBC; ELAVL1; PDZD3; SLC9A3R2; SLC9A3R1; PDZK1;
  1. What is the species homology for "SLC22A5 Antibody - C-terminal region (ARP63404_P050)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Human, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Rabbit".

  2. How long will it take to receive "SLC22A5 Antibody - C-terminal region (ARP63404_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "SLC22A5 Antibody - C-terminal region (ARP63404_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "SLC22A5 Antibody - C-terminal region (ARP63404_P050)"?

    This target may also be called "CDSP, OCTN2" in publications.

  5. What is the shipping cost for "SLC22A5 Antibody - C-terminal region (ARP63404_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "SLC22A5 Antibody - C-terminal region (ARP63404_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "SLC22A5 Antibody - C-terminal region (ARP63404_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "61kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "SLC22A5 Antibody - C-terminal region (ARP63404_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "SLC22A5"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "SLC22A5"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "SLC22A5"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "SLC22A5"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "SLC22A5"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "SLC22A5"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:SLC22A5 Antibody - C-terminal region (ARP63404_P050)
Your Rating
We found other products you might like!