SLC22A2 Antibody - middle region (OABB01877)

Catalog No: OABB01877

Size:100UG

Click here to learn more about Aviva's By-Request Conjugation Service.

Anti-SLC22A2 Picoband antibody, OABB01877, Western blotting
All lanes: Anti SLC22A2 (OABB01877) at 0.5ug/ml
Lane 1: Rat Brain Tissue Lysate at 50ug
Lane 2: Mouse Brain Tissue Lysate at 50ug
Predicted bind size: 63KD
Observed bind size: 63KD

Anti-SLC22A2 Picoband antibody, OABB01877, IHC(P)
IHC(P): Mouse Kidney Tissue

Anti-SLC22A2 Picoband antibody, OABB01877, IHC(P)
IHC(P): Rat Kidney Tissue

Product Info

• Tested Species Reactivity: Mouse, Rat
• Predicted Species Reactivity: Human|Mouse|Rat
• Product Format: Lyophilized. Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
• Clonality: Polyclonal
• Clone: Polyclonal
• Isotype: Rabbit IgG
• Host: Rabbit
• Application: Immunohistochemistry|Western blot
• Additional Information: Notes: WB: The detection limit for SLC22A2 is approximately 0.1ng/lane under reducing conditions.
  Tested Species: In-house tested species with positive results.
  Predicted Species: Species predicted to be fit for the product based on sequence similarities.
  By Heat: Boiling the paraffin sections in 10mM citrate buffer, pH6.0, for 20mins is required for the staining of formalin/paraffin sections.
  Other applications have not been tested.
  Optimal dilutions should be determined by end users.
  Background: SLC22A2 is also known as OCT2. It is mapped to 6q25.3. Polyspecific organic cation transporters in the liver, kidney, intestine, and other organs are critical for elimination of many endogenous small organic cations as well as a wide array of drugs and environmental toxins. This gene is one of three similar cation transporter genes located in a cluster on chromosome 6. The encoded protein contains twelve putative transmembrane domains and is a plasma integral membrane protein. It is found primarily in the kidney, where it may mediate the first step in cation reabsorption.
• Reconstitution and Storage: 2°C to 8°C|-20°C
• Immunogen: Polypeptide
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Human
• Peptide Sequence: Synthetic peptide located within the following region: ETIEEAENMQRPRKNKEKMIYLQVQKLDIPLN
• Concentration: 500 ug/ml
• Specificity: No cross reactivity with other proteins.
• Application Info: Western blot: 0.1-0.5 ug/ml: Mouse, Rat: Human
• Reference: 1. "Entrez Gene: SLC22A2 solute carrier family 22 (organic cation transporter), member 2".
  2. Koehler, M. R., Wissinger, B., Gorboulev, V., Koepsell, H., Schmid, M. The two human organic cation transporter genes SLC22A1 and SLC22A2 are located on chromosome 6q26. Cytogenet. Cell Genet. 79: 198-200, 1997.
  
• Storage Buffer: Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
• Description: Rabbit IgG polyclonal antibody for Solute carrier family 22 member 2(SLC22A2) detection. Tested with WB, IHC-P in Human;Mouse;Rat.

Target Info

• Gene Symbol: SLC22A2
• Gene Full Name: solute carrier family 22 member 2
• Alias Symbols: OCT2;organic cation transporter 2;solute carrier family 22 (organic cation transporter), member 2;solute carrier family 22 member 2.
• NCBI Gene Id: 6582
• Protein Name: Solute carrier family 22 member 2
• Description of Target: Mediates tubular uptake of organic compounds from circulation. Mediates the influx of agmatine, dopamine, noradrenaline (norepinephrine), serotonin, choline, famotidine, ranitidine, histamin, creatinine, amantadine, memantine, acriflavine, 4-[4-(dimethylamino)-styryl]-N-methylpyridinium ASP, amiloride, metformin, N-1-methylnicotinamide (NMN), tetraethylammonium (TEA), 1-methyl-4-phenylpyridinium (MPP), cimetidine, cisplatin and oxaliplatin. Cisplatin may develop a nephrotoxic action. Transport of creatinine is inhibited by fluoroquinolones such as DX-619 and LVFX. This transporter is a major determinant of the anticancer activity of oxaliplatin and may contribute to antitumor specificity.
• Uniprot ID: O15244
• Molecular Weight: 62581 MW