SAVE NOW with 10% off all Recombinant Antibodies Shop Now

Catalog No: ARP33840_P050-Biotin
Size:100ul
Price: $434.00
SKU
ARP33840_P050-Biotin
Availability: Domestic: within 1-2 days delivery | International: 1-2 days
Bulk
Order
Aviva's
Satisfaction
Guarantee
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.

SLC1A2 Antibody - N-terminal region : Biotin (ARP33840_P050-Biotin)

Datasheets/ManualsPrintable datasheet for anti-SLC1A2 (ARP33840_P050-Biotin) antibody
Product Info
Predicted Species ReactivityHuman, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Sheep, Zebrafish
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer.
ClonalityPolyclonal
HostRabbit
ConjugationBiotin
ApplicationIHC, WB
Additional InformationIHC Information: Paraffin embedded brain, cortex tissue, tested with an antibody dilution of 5 ug/ml.
Reconstitution and StorageAll conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
ImmunogenThe immunogen is a synthetic peptide directed towards the N terminal region of human SLC1A2
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceCow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Sheep: 100%; Zebrafish: 92%
Peptide SequenceSynthetic peptide located within the following region: PGNPKLKKQLGPGKKNDEVSSLDAFLDLIRNLFPENLVQACFQQIQTVTK
Concentration0.5 mg/ml
Blocking PeptideFor anti-SLC1A2 (ARP33840_P050-Biotin) antibody is Catalog # AAP33840 (Previous Catalog # AAPP04911)
ReferenceUhl,G.R., (2008) Arch. Gen. Psychiatry 65 (6), 683-693
Publications

Pretto, D. I. et al. Reduced excitatory amino acid transporter 1 and metabotropic glutamate receptor 5 expression in the cerebellum of fragile X mental retardation gene 1 premutation carriers with fragile X-associated tremor/ataxia syndrome. Neurobiol. Aging 35, 1189-97 (2014). WB, Human, Mouse, Bovine, Dog, Pig, Horse, Rabbit, Rat, Guinea pig, Sheep, Zebrafish 24332449

Gene SymbolSLC1A2
Gene Full NameSolute carrier family 1 (glial high affinity glutamate transporter), member 2
Alias SymbolsHBGT, DEE41, EAAT2, GLT-1, EIEE41
NCBI Gene Id6506
Protein NameExcitatory amino acid transporter 2
Description of TargetSLC1A2 is a member of a family of solute transporter proteins. The membrane-bound protein is the principal transporter that clears the excitatory neurotransmitter glutamate from the extracellular space at synapses in the central nervous system. Glutamate clearance is necessary for proper synaptic activation and to prevent neuronal damage from excessive activation of glutamate receptors. Mutations in and decreased expression of this protein are associated with amyotrophic lateral sclerosis. Alternatively spliced transcript variants of this gene have been described, but their full-length nature is not known.This gene encodes a member of a family of solute transporter proteins. The membrane-bound protein is the principal transporter that clears the excitatory neurotransmitter glutamate from the extracellular space at synapses in the central nervous system. Glutamate clearance is necessary for proper synaptic activation and to prevent neuronal damage from excessive activation of glutamate receptors. Mutations in and decreased expression of this protein are associated with amyotrophic lateral sclerosis. Alternatively spliced transcript variants of this gene have been described, but their full-length nature is not known. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
Uniprot IDP43004
Protein Accession #NP_004162
Nucleotide Accession #NM_004171
Protein Size (# AA)574
Molecular Weight62kDa
Protein InteractionsPML; GRB2; AJUBA; SLC1A2; MYCN; RELA;
  1. What is the species homology for "SLC1A2 Antibody - N-terminal region : Biotin (ARP33840_P050-Biotin)"?

    The tested species reactivity for this item is "". This antibody is predicted to have homology to "Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Sheep, Zebrafish".

  2. How long will it take to receive "SLC1A2 Antibody - N-terminal region : Biotin (ARP33840_P050-Biotin)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "SLC1A2 Antibody - N-terminal region : Biotin (ARP33840_P050-Biotin)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "SLC1A2 Antibody - N-terminal region : Biotin (ARP33840_P050-Biotin)"?

    This target may also be called "HBGT, DEE41, EAAT2, GLT-1, EIEE41" in publications.

  5. What is the shipping cost for "SLC1A2 Antibody - N-terminal region : Biotin (ARP33840_P050-Biotin)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "SLC1A2 Antibody - N-terminal region : Biotin (ARP33840_P050-Biotin)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "SLC1A2 Antibody - N-terminal region : Biotin (ARP33840_P050-Biotin)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "62kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "SLC1A2 Antibody - N-terminal region : Biotin (ARP33840_P050-Biotin)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "SLC1A2"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "SLC1A2"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "SLC1A2"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "SLC1A2"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "SLC1A2"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "SLC1A2"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:SLC1A2 Antibody - N-terminal region : Biotin (ARP33840_P050-Biotin)
Your Rating
We found other products you might like!