Search Antibody, Protein, and ELISA Kit Solutions

SLC1A2 antibody - N-terminal region (ARP33840_P050)

100 ul
In Stock
Request Bulk Order Quote

Conjugation Options

ARP33840_P050-FITC Conjugated

ARP33840_P050-HRP Conjugated

ARP33840_P050-Biotin Conjugated

Gene Symbol:
NCBI Gene Id:
Official Gene Full Name:
Solute carrier family 1 (glial high affinity glutamate transporter), member 2
Protein Name:
Excitatory amino acid transporter 2
Swissprot Id:
Protein Accession #:
Nucleotide Accession #:
Alias Symbols:
Replacement Item:
This antibody may replace item sc-135892 from Santa Cruz Biotechnology.
Description of Target:
SLC1A2 is a member of a family of solute transporter proteins. The membrane-bound protein is the principal transporter that clears the excitatory neurotransmitter glutamate from the extracellular space at synapses in the central nervous system. Glutamate clearance is necessary for proper synaptic activation and to prevent neuronal damage from excessive activation of glutamate receptors. Mutations in and decreased expression of this protein are associated with amyotrophic lateral sclerosis. Alternatively spliced transcript variants of this gene have been described, but their full-length nature is not known.This gene encodes a member of a family of solute transporter proteins. The membrane-bound protein is the principal transporter that clears the excitatory neurotransmitter glutamate from the extracellular space at synapses in the central nervous system. Glutamate clearance is necessary for proper synaptic activation and to prevent neuronal damage from excessive activation of glutamate receptors. Mutations in and decreased expression of this protein are associated with amyotrophic lateral sclerosis. Alternatively spliced transcript variants of this gene have been described, but their full-length nature is not known. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
Protein Size (# AA):
Molecular Weight:
Affinity Purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express SLC1A2.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express SLC1A2.
The immunogen is a synthetic peptide directed towards the N terminal region of human SLC1A2
Tested Species Reactivity:
Human, Rat
Predicted Homology Based on Immunogen Sequence:
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Sheep: 100%; Zebrafish: 92%
Complete computational species homology data:
Anti-SLC1A2 (ARP33840_P050)
Peptide Sequence:
Synthetic peptide located within the following region: PGNPKLKKQLGPGKKNDEVSSLDAFLDLIRNLFPENLVQACFQQIQTVTK
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
Blocking Peptide:
For anti-SLC1A2 (ARP33840_P050) antibody is Catalog # AAP33840 (Previous Catalog # AAPP04911)
Printable datasheet for anti-SLC1A2 (ARP33840_P050) antibody
Additional Information:
IHC Information: Paraffin embedded brain, cortex tissue, tested with an antibody dilution of 5 ug/ml.
Target Reference:
Uhl,G.R., (2008) Arch. Gen. Psychiatry 65 (6), 683-693

Pretto, D. I. et al. Reduced excitatory amino acid transporter 1 and metabotropic glutamate receptor 5 expression in the cerebellum of fragile X mental retardation gene 1 premutation carriers with fragile X-associated tremor/ataxia syndrome. Neurobiol. Aging 35, 1189-97 (2014). IHC, WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep, Zebrafish 24332449

Product Reviews

Average Rating:
1 review
5 star
4 star
3 star
2 star
1 star
  • Date - Newest First
  • Date - Newest First
  • Date - Latest First
  • Highest Rated
  • Lowest Rated
  • Most Helpful
  • Ownership

1 Item(s)

316/11/2018 23:55
  • Overall Experience:
  • Quality:
Mouse spinal cord lysates in WB

Submitted by:

Santosh D'Mello


Sample type/lane description: Mouse spinal cord lysates; 15 week old (left) and 10 week old (right) wild-type and transgenic mice.

Image (right):

-          Lane 1-3:30ug spinal cord lysate (WT mice, 10 weeks old)

-          Lane 4-6:30ug spinal cord lysate (transgenic mice, 10 weeks old)

Image (left):

-          Lane 1-2:30ug spinal cord lysate (WT mice, 15 weeks old)

-          Lane 3-6:30ug spinal cord lysate (transgenic mice, 15 weeks old)

Primary antibody dilution: 1:1000; 20 – 24 hours at 4°C.
Secondary antibody and dilution: Goat anti rabbit IgG; 1:10000.
Blocking buffer used: 5% non-fat milk in 0.05% TBST.

Show more comments (-2) Hide comments

1 Item(s)

What kind of abuse are you reporting?
    Please, wait...