SLC19A1 Antibody - N-terminal region : FITC (ARP44167_T100-FITC)

Catalog No: ARP44167_T100-FITC

Size:100ul

Product Info

• Predicted Species Reactivity: Human
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.
• Clonality: Polyclonal
• Host: Rabbit
• Conjugation: FITC: Fluorescein Isothiocyanate
• Application: IHC, WB
• Reconstitution and Storage: All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human SLC19A1
• Predicted Homology Based on Immunogen Sequence: Human: 100%
• Peptide Sequence: Synthetic peptide located within the following region: MVPSSPAVEKQVPVEPGPDPELRSWRHLVCYLCFYGFMAQIRPGESFITP
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-SLC19A1 (ARP44167_T100-FITC) antibody is Catalog # AAP44167 (Previous Catalog # AAPP11943)
• Sample Type Confirmation:

  SLC19A1 is strongly supported by BioGPS gene expression data to be expressed in Jurkat

• Reference: Payton,S.G., (2005) Biochim. Biophys. Acta 1731 (2), 115-124
• Publications:

  Marchi, E. et al. Pralatrexate is synergistic with the proteasome inhibitor bortezomib in in vitro and in vivo models of T-cell lymphoid malignancies. Clin. Cancer Res. 16, 3648-58 (2010). WB, IHC, Human 20501616

  Halwachs, S., Lakoma, C., Schäfer, I., Seibel, P. & Honscha, W. The antiepileptic drugs phenobarbital and carbamazepine reduce transport of methotrexate in rat choroid plexus by down-regulation of the reduced folate carrier. Mol. Pharmacol. 80, 621-9 (2011). WB, IHC, Human 21737571

Target Info

• Gene Symbol: SLC19A1
• Gene Full Name: Solute carrier family 19 (folate transporter), member 1
• Alias Symbols: RFC, CHMD, FOLT, IFC1, REFC, RFC1, hRFC, IFC-1, MEGAF, RFT-1, hSLC19A1
• NCBI Gene Id: 6573
• Protein Name: Folate transporter 1
• Description of Target: Transport of folate compounds into mammalian cells can occur via receptor-mediated or carrier-mediated mechanisms. A functional coordination between these 2 mechanisms has been proposed to be the method of folate uptake in certain cell types. Methotrexate (MTX) is an antifolate chemotherapeutic agent that is actively transported by the carrier-mediated uptake system. SLC19A1 plays a role in maintaining intracellular concentrations of folate.Transport of folate compounds into mammalian cells can occur via receptor-mediated (see MIM 136430) or carrier-mediated mechanisms. A functional coordination between these 2 mechanisms has been proposed to be the method of folate uptake in certain cell types. Methotrexate (MTX) is an antifolate chemotherapeutic agent that is actively transported by the carrier-mediated uptake system. RFC1 plays a role in maintaining intracellular concentrations of folate.[supplied by OMIM].
• Uniprot ID: P41440
• Protein Accession #: NP_919231
• Nucleotide Accession #: NM_194255
• Protein Size (# AA): 591
• Molecular Weight: 65kDa
• Protein Interactions: UBC;