SLC19A1 Antibody - N-terminal region (ARP44167_T100)

Catalog No: ARP44167_T100

25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 1 ug/mL of the antibody was used in this experiment. Recommended dilution is 1-3 ug/mL for this antibody.

Human kidney

Product Info

• Tested Species Reactivity: Human
• Predicted Species Reactivity: Human
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: IHC, WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human SLC19A1
• Purification: Protein A purified
• Predicted Homology Based on Immunogen Sequence: Human: 100%
• Peptide Sequence: Synthetic peptide located within the following region: MVPSSPAVEKQVPVEPGPDPELRSWRHLVCYLCFYGFMAQIRPGESFITP
• Concentration: 1.0 mg/ml
• Blocking Peptide: For anti-SLC19A1 (ARP44167_T100) antibody is Catalog # AAP44167 (Previous Catalog # AAPP11943)
• Sample Type Confirmation:

  SLC19A1 is strongly supported by BioGPS gene expression data to be expressed in Jurkat

• Enhanced Validation:

  Relative Expression (Western Blot)

• Reference: Payton,S.G., (2005) Biochim. Biophys. Acta 1731 (2), 115-124
• Publications:

  Halwachs, S., Lakoma, C., Schäfer, I., Seibel, P. & Honscha, W. The antiepileptic drugs phenobarbital and carbamazepine reduce transport of methotrexate in rat choroid plexus by down-regulation of the reduced folate carrier. Mol. Pharmacol. 80, 621-9 (2011). 21737571

  Marchi, E. et al. Pralatrexate is synergistic with the proteasome inhibitor bortezomib in in vitro and in vivo models of T-cell lymphoid malignancies. Clin. Cancer Res. 16, 3648-58 (2010). 20501616

Target Info

• Gene Symbol: SLC19A1
• Gene Full Name: Solute carrier family 19 (folate transporter), member 1
• Alias Symbols: RFC, CHMD, FOLT, IFC1, REFC, RFC1, hRFC, IFC-1, MEGAF, RFT-1, hSLC19A1
• NCBI Gene Id: 6573
• Protein Name: Folate transporter 1
• Description of Target: Transport of folate compounds into mammalian cells can occur via receptor-mediated or carrier-mediated mechanisms. A functional coordination between these 2 mechanisms has been proposed to be the method of folate uptake in certain cell types. Methotrexate (MTX) is an antifolate chemotherapeutic agent that is actively transported by the carrier-mediated uptake system. SLC19A1 plays a role in maintaining intracellular concentrations of folate.Transport of folate compounds into mammalian cells can occur via receptor-mediated (see MIM 136430) or carrier-mediated mechanisms. A functional coordination between these 2 mechanisms has been proposed to be the method of folate uptake in certain cell types. Methotrexate (MTX) is an antifolate chemotherapeutic agent that is actively transported by the carrier-mediated uptake system. RFC1 plays a role in maintaining intracellular concentrations of folate.[supplied by OMIM].
• Uniprot ID: P41440
• Protein Accession #: NP_919231
• Nucleotide Accession #: NM_194255
• Protein Size (# AA): 591
• Molecular Weight: 65 kDa
• Protein Interactions: UBC;