Search Antibody, Protein, and ELISA Kit Solutions

SLC19A1 Antibody - N-terminal region (ARP44167_T100)

100 ul
In Stock
Request Bulk Order Quote

Conjugation Options

ARP44167_T100-FITC Conjugated

ARP44167_T100-HRP Conjugated

ARP44167_T100-Biotin Conjugated

Tested Species Reactivity:
Predicted Species Reactivity:
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Gene Symbol:
Official Gene Full Name:
Solute carrier family 19 (folate transporter), member 1
NCBI Gene Id:
Protein Name:
Folate transporter 1
Swissprot Id:
Protein Accession #:
Nucleotide Accession #:
Alias Symbols:
Replacement Item:
This antibody may replace item sc-47357 from Santa Cruz Biotechnology.
Description of Target:
Transport of folate compounds into mammalian cells can occur via receptor-mediated or carrier-mediated mechanisms. A functional coordination between these 2 mechanisms has been proposed to be the method of folate uptake in certain cell types. Methotrexate (MTX) is an antifolate chemotherapeutic agent that is actively transported by the carrier-mediated uptake system. SLC19A1 plays a role in maintaining intracellular concentrations of folate.Transport of folate compounds into mammalian cells can occur via receptor-mediated (see MIM 136430) or carrier-mediated mechanisms. A functional coordination between these 2 mechanisms has been proposed to be the method of folate uptake in certain cell types. Methotrexate (MTX) is an antifolate chemotherapeutic agent that is actively transported by the carrier-mediated uptake system. RFC1 plays a role in maintaining intracellular concentrations of folate.[supplied by OMIM].
Protein Size (# AA):
Molecular Weight:
Protein A purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express SLC19A1.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express SLC19A1.
The immunogen is a synthetic peptide directed towards the N terminal region of human SLC19A1
Predicted Homology Based on Immunogen Sequence:
Human: 100%
Complete computational species homology data:
Anti-SLC19A1 (ARP44167_T100)
Peptide Sequence:
Synthetic peptide located within the following region: MVPSSPAVEKQVPVEPGPDPELRSWRHLVCYLCFYGFMAQIRPGESFITP
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
Blocking Peptide:
For anti-SLC19A1 (ARP44167_T100) antibody is Catalog # AAP44167 (Previous Catalog # AAPP11943)
Printable datasheet for anti-SLC19A1 (ARP44167_T100) antibody
Sample Type Confirmation:

SLC19A1 is strongly supported by BioGPS gene expression data to be expressed in Jurkat

Target Reference:
Payton,S.G., (2005) Biochim. Biophys. Acta 1731 (2), 115-124

Halwachs, S., Lakoma, C., Schäfer, I., Seibel, P. & Honscha, W. The antiepileptic drugs phenobarbital and carbamazepine reduce transport of methotrexate in rat choroid plexus by down-regulation of the reduced folate carrier. Mol. Pharmacol. 80, 621-9 (2011). IHC, WB, Human 21737571

Marchi, E. et al. Pralatrexate is synergistic with the proteasome inhibitor bortezomib in in vitro and in vivo models of T-cell lymphoid malignancies. Clin. Cancer Res. 16, 3648-58 (2010). IHC, WB, Human 20501616

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...