Catalog No: ARP44167_T100
Price: $0.00
SKU
ARP44167_T100
Availability: Domestic: within 1-2 days delivery | International: 1-2 days
Bulk
Order
Aviva's
Satisfaction
Guarantee
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.
Datasheets/ManualsPrintable datasheet for anti-SLC19A1 (ARP44167_T100) antibody
Product Info
Tested Species ReactivityHuman
Predicted Species ReactivityHuman
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationIHC, WB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
ImmunogenThe immunogen is a synthetic peptide directed towards the N terminal region of human SLC19A1
PurificationProtein A purified
Predicted Homology Based on Immunogen SequenceHuman: 100%
Peptide SequenceSynthetic peptide located within the following region: MVPSSPAVEKQVPVEPGPDPELRSWRHLVCYLCFYGFMAQIRPGESFITP
Concentration1.0 mg/ml
Blocking PeptideFor anti-SLC19A1 (ARP44167_T100) antibody is Catalog # AAP44167 (Previous Catalog # AAPP11943)
Sample Type Confirmation

SLC19A1 is strongly supported by BioGPS gene expression data to be expressed in Jurkat

Enhanced Validation
WBY
SPR
YCHAROS
ReferencePayton,S.G., (2005) Biochim. Biophys. Acta 1731 (2), 115-124
Publications

Halwachs, S., Lakoma, C., Schäfer, I., Seibel, P. & Honscha, W. The antiepileptic drugs phenobarbital and carbamazepine reduce transport of methotrexate in rat choroid plexus by down-regulation of the reduced folate carrier. Mol. Pharmacol. 80, 621-9 (2011). 21737571

Marchi, E. et al. Pralatrexate is synergistic with the proteasome inhibitor bortezomib in in vitro and in vivo models of T-cell lymphoid malignancies. Clin. Cancer Res. 16, 3648-58 (2010). 20501616

Gene SymbolSLC19A1
Gene Full NameSolute carrier family 19 (folate transporter), member 1
Alias SymbolsRFC, CHMD, FOLT, IFC1, REFC, RFC1, hRFC, IFC-1, MEGAF, RFT-1, hSLC19A1
NCBI Gene Id6573
Protein NameFolate transporter 1
Description of TargetTransport of folate compounds into mammalian cells can occur via receptor-mediated or carrier-mediated mechanisms. A functional coordination between these 2 mechanisms has been proposed to be the method of folate uptake in certain cell types. Methotrexate (MTX) is an antifolate chemotherapeutic agent that is actively transported by the carrier-mediated uptake system. SLC19A1 plays a role in maintaining intracellular concentrations of folate.Transport of folate compounds into mammalian cells can occur via receptor-mediated (see MIM 136430) or carrier-mediated mechanisms. A functional coordination between these 2 mechanisms has been proposed to be the method of folate uptake in certain cell types. Methotrexate (MTX) is an antifolate chemotherapeutic agent that is actively transported by the carrier-mediated uptake system. RFC1 plays a role in maintaining intracellular concentrations of folate.[supplied by OMIM].
Uniprot IDP41440
Protein Accession #NP_919231
Nucleotide Accession #NM_194255
Protein Size (# AA)591
Molecular Weight65kDa
Protein InteractionsUBC;
  1. What is the species homology for "SLC19A1 Antibody - N-terminal region (ARP44167_T100)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Human".

  2. How long will it take to receive "SLC19A1 Antibody - N-terminal region (ARP44167_T100)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "SLC19A1 Antibody - N-terminal region (ARP44167_T100)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "SLC19A1 Antibody - N-terminal region (ARP44167_T100)"?

    This target may also be called "RFC, CHMD, FOLT, IFC1, REFC, RFC1, hRFC, IFC-1, MEGAF, RFT-1, hSLC19A1" in publications.

  5. What is the shipping cost for "SLC19A1 Antibody - N-terminal region (ARP44167_T100)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "SLC19A1 Antibody - N-terminal region (ARP44167_T100)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "SLC19A1 Antibody - N-terminal region (ARP44167_T100)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "65kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "SLC19A1 Antibody - N-terminal region (ARP44167_T100)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "SLC19A1"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "SLC19A1"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "SLC19A1"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "SLC19A1"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "SLC19A1"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "SLC19A1"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:SLC19A1 Antibody - N-terminal region (ARP44167_T100)
Your Rating
We found other products you might like!