Size:100 ul
Special Price $229.00 Regular Price $289.00
In stock
SKU
ARP43845_P050
Request Bulk
Order Quote
Aviva's
Satisfaction
Guarantee
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email: info@avivasysbio.com
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Conjugation Options

ARP43845_P050-FITC Conjugated

ARP43845_P050-HRP Conjugated

ARP43845_P050-Biotin Conjugated

SLC18A2 Antibody - N-terminal region (ARP43845_P050)

Catalog#: ARP43845_P050
Domestic: within 1-2 days delivery International: 1-2 days
More Information
Tested Species Reactivity Human
Predicted Species Reactivity Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clonality Polyclonal
Host Rabbit
Application IHC, WB
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Replacement Item This antibody may replace item sc-15314 from Santa Cruz Biotechnology.
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human SLC18A2
Purification Affinity Purified
Predicted Homology Based on Immunogen Sequence Cow: 100%; Dog: 86%; Guinea Pig: 86%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 93%; Rabbit: 100%; Rat: 100%
Complete computational species homology data Anti-SLC18A2 (ARP43845_P050)
Peptide Sequence Synthetic peptide located within the following region: NATRDLTLHQTATQHMVTNASAVPSDCPSEDKDLLNENVQVGLLFASKAT
Concentration Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide For anti-SLC18A2 (ARP43845_P050) antibody is Catalog # AAP43845 (Previous Catalog # AAPS14306)
Datasheets/Manuals Printable datasheet for anti-SLC18A2 (ARP43845_P050) antibody
Target Reference Yamamoto,S., (2006) Neurosci. Lett. 396 (3), 187-191
Gene Symbol SLC18A2
Official Gene Full Name Solute carrier family 18 (vesicular monoamine), member 2
Alias Symbols MGC120477, MGC120478, MGC26538, SVAT, SVMT, VAT2, VMAT2
NCBI Gene Id 6571
Protein Name Synaptic vesicular amine transporter
Description of Target The vesicular monoamine transporter acts to accumulate cytosolic monoamines into synaptic vesicles, using the proton gradient maintained across the synaptic vesicular membrane. Its proper function is essential to the correct activity of the monoaminergic systems that have been implicated in several human neuropsychiatric disorders. The transporter is a site of action of important drugs, including reserpine and tetrabenazine.
Swissprot Id Q05940
Protein Accession # NP_003045
Nucleotide Accession # NM_003054
Protein Size (# AA) 514
Molecular Weight 56kDa
Tissue Tool Find tissues and cell lines supported by DNA array analysis to express SLC18A2.
RNA Seq Find tissues and cell lines supported by RNA-seq analysis to express SLC18A2.
Protein Interactions PARK7; UBC; CSNK1A1; CSNK2A2; CSNK2A1;
Write Your Own Review
You're reviewing:SLC18A2 Antibody - N-terminal region (ARP43845_P050)
Your Rating