SLC12A1 Antibody - N-terminal region (OABB01875)

Catalog No: OABB01875

Size:100UG

Anti-SLC12A1 Picoband antibody, OABB01875, Western blotting
All lanes: Anti SLC12A1 (OABB01875) at 0.5ug/ml
Lane 1: HELA Whole Cell Lysate at 40ug
Lane 2: JURKAT Whole Cell Lysate at 40ug
Lane 3: SKOV Whole Cell Lysate at 40ug
Lane 4: Mouse Kidney Tissue Lysate at 50ug
Predicted bind size: 121KD
Observed bind size: 121KD

Anti-SLC12A1 Picoband antibody, OABB01875, IHC(P)
IHC(P): Human Kidney Cancer Tissue

Anti-SLC12A1 Picoband antibody, OABB01875, IHC(P)
IHC(P): Mouse Kidney Tissue

Anti-SLC12A1 Picoband antibody, OABB01875, IHC(P)
IHC(P): Rat Kidney Tissue

Product Info

• Tested Species Reactivity: Human, Mouse, Rat
• Predicted Species Reactivity: Human|Monkey|Mouse|Rat
• Product Format: Lyophilized. Each vial contains 4 mg Trehalose, 0.9 mg NaCl and 0.2 mg Na2HPO4.
• Clonality: Polyclonal
• Clone: Polyclonal
• Isotype: Rabbit IgG
• Host: Rabbit
• Application: Immunohistochemistry|Western blot
• Additional Information: Notes: WB: The detection limit for SLC12A1 is approximately 0.1ng/lane under reducing conditions.
  Tested Species: In-house tested species with positive results.
  By Heat: Boiling the paraffin sections in 10mM citrate buffer, pH6.0, for 20mins is required for the staining of formalin/paraffin sections.
  Other applications have not been tested.
  Optimal dilutions should be determined by end users.
  
  Background: Solute carrier family 12 (sodium/potassium/chloride transporters), member 1, also called NKCC2 is specifically found in cells of the thick ascending limb of the loop of Henle in nephrons, the basic functional units of the kidney. This gene is mapped to 15q21.1. This gene encodes a kidney-specific sodium-potassium-chloride cotransporter that is expressed on the luminal membrane of renal epithelial cells of the thick ascending limb of Henle's loop and the macula densa. It plays a key role in concentrating urine and accounts for most of the NaCl resorption. It is sensitive to such diuretics as furosemide and bumetanide. Some Bartter-like syndromes result from defects in this gene. This gene plays a vital role in the regulation of ionic balance and cell volume.
• Reconstitution and Storage: 2°C to 8°C|-20°C
• Immunogen: Polypeptide
• Purification: Affinity Purified
• Peptide Sequence: Synthetic peptide located within the following region: DEAQKRLRISFRPGNQECYDNFLQSGETAKTD
• Concentration: 500 ug/ml
• Specificity: No cross reactivity with other proteins.
• Application Info: Western blot: 0.1-0.5 ug/ml: Human, Mouse
  Immunohistochemistry (Paraffin-embedded Section): 0.5-1 ug/ml: Human, Mouse, Rat: By Heat
• Reference: 1. Nozu, K., Iijima, K., Kawai, K., Nozu, Y., Nishida, A., Takeshima, Y., Fu, X. J., Hashimura, Y., Kaito, H., Nakanishi, K., Yoshikawa, N., Matsuo, M. In vivo and in vitro splicing assay of SLC12A1 in an antenatal salt-losing tubulopathy patient with an intronic mutation. Hum. Genet. 126: 533-538, 2009.
  2. Takahashi, N., Chernavvsky, D. R., Gomez, R. A., Igarashi, P., Gitelman, H. J., Smithies, O.Uncompensated polyuria in a mouse model of Bartter's syndrome. Proc. Nat. Acad. Sci. 97: 5434-5439, 2000.
  
• Storage Buffer: Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
• Description: Rabbit IgG polyclonal antibody for Solute carrier family 12 member 1(SLC12A1) detection. Tested with WB, IHC-P in Human;Mouse;Rat.

Target Info

• Gene Symbol: SLC12A1
• Gene Full Name: solute carrier family 12 member 1
• Alias Symbols: BSC1;bumetanide-sensitive sodium-(potassium)-chloride cotransporter 2;kidney-specific Na-K-Cl symporter;Na-K-2Cl cotransporter;NKCC2;NKCC2A variant A;solute carrier family 12 (sodium/potassium/chloride transporter), member 1;solute carrier family 12 (sodium/potassium/chloride transporters), member 1;solute carrier family 12 member 1.
• NCBI Gene Id: 6557
• Protein Name: Solute carrier family 12 member 1
• Description of Target: Electrically silent transporter system. Mediates sodium and chloride reabsorption. Plays a vital role in the regulation of ionic balance and cell volume.
• Uniprot ID: Q13621
• Molecular Weight: 121450 MW