- Toll Free: 888-880-0001
- Phone: 858-552-6979
- Email: info@avivasysbio.com
- $55: Antibody & Protein in US
- $55 + $25/Kit in US
- Contact us for international orders.
Datasheets/Manuals | Printable datasheet for SLC12A1 Antibody - N-terminal region (OABB01875) |
---|
Tested Species Reactivity | Human, Mouse, Rat |
---|---|
Predicted Species Reactivity | Human|Monkey|Mouse|Rat |
Product Format | Lyophilized. Each vial contains 4 mg Trehalose, 0.9 mg NaCl and 0.2 mg Na2HPO4. |
Clonality | Polyclonal |
Clone | Polyclonal |
Isotype | Rabbit IgG |
Host | Rabbit |
Application | Immunohistochemistry|Western blot |
Additional Information | Notes: WB: The detection limit for SLC12A1 is approximately 0.1ng/lane under reducing conditions. Tested Species: In-house tested species with positive results. By Heat: Boiling the paraffin sections in 10mM citrate buffer, pH6.0, for 20mins is required for the staining of formalin/paraffin sections. Other applications have not been tested. Optimal dilutions should be determined by end users. |
:: | Background: Solute carrier family 12 (sodium/potassium/chloride transporters), member 1, also called NKCC2 is specifically found in cells of the thick ascending limb of the loop of Henle in nephrons, the basic functional units of the kidney. This gene is mapped to 15q21.1. This gene encodes a kidney-specific sodium-potassium-chloride cotransporter that is expressed on the luminal membrane of renal epithelial cells of the thick ascending limb of Henle's loop and the macula densa. It plays a key role in concentrating urine and accounts for most of the NaCl resorption. It is sensitive to such diuretics as furosemide and bumetanide. Some Bartter-like syndromes result from defects in this gene. This gene plays a vital role in the regulation of ionic balance and cell volume. |
Reconstitution and Storage | 2°C to 8°C|-20°C |
Immunogen | Polypeptide |
Purification | Affinity Purified |
Peptide Sequence | Synthetic peptide located within the following region: DEAQKRLRISFRPGNQECYDNFLQSGETAKTD |
Concentration | 500 ug/ml |
Specificity | No cross reactivity with other proteins. |
Application Info | Western blot: 0.1-0.5 ug/ml: Human, Mouse Immunohistochemistry (Paraffin-embedded Section): 0.5-1 ug/ml: Human, Mouse, Rat: By Heat |
Reference | 1. Nozu, K., Iijima, K., Kawai, K., Nozu, Y., Nishida, A., Takeshima, Y., Fu, X. J., Hashimura, Y., Kaito, H., Nakanishi, K., Yoshikawa, N., Matsuo, M. In vivo and in vitro splicing assay of SLC12A1 in an antenatal salt-losing tubulopathy patient with an intronic mutation. Hum. Genet. 126: 533-538, 2009. 2. Takahashi, N., Chernavvsky, D. R., Gomez, R. A., Igarashi, P., Gitelman, H. J., Smithies, O.Uncompensated polyuria in a mouse model of Bartter's syndrome. Proc. Nat. Acad. Sci. 97: 5434-5439, 2000. |
Storage Buffer | Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3. |
Description | Rabbit IgG polyclonal antibody for Solute carrier family 12 member 1(SLC12A1) detection. Tested with WB, IHC-P in Human;Mouse;Rat. |
Gene Symbol | SLC12A1 |
---|---|
Gene Full Name | solute carrier family 12 member 1 |
Alias Symbols | BSC1;bumetanide-sensitive sodium-(potassium)-chloride cotransporter 2;kidney-specific Na-K-Cl symporter;Na-K-2Cl cotransporter;NKCC2;NKCC2A variant A;solute carrier family 12 (sodium/potassium/chloride transporter), member 1;solute carrier family 12 (sodium/potassium/chloride transporters), member 1;solute carrier family 12 member 1. |
NCBI Gene Id | 6557 |
Protein Name | Solute carrier family 12 member 1 |
Description of Target | Electrically silent transporter system. Mediates sodium and chloride reabsorption. Plays a vital role in the regulation of ionic balance and cell volume. |
Uniprot ID | Q13621 |
Molecular Weight | 121450 MW |
- Protocol:
- Reconstitution & Storage Instructions
- Western Blotting/Immunoblotting (WB/IB) Protocol
- Immunohistochemistry (IHC) Protocol
- Immunocytochemistry (ICC) Protocol
- Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol
- Blocking Peptide Competition Protocol (BPCP)
- Immunoprecipitation (IP) Protocol
- Antibody Array (AA) Protocol
- Tips Information:
-
See our General FAQ page.
-
What is the species homology for "SLC12A1 Antibody - N-terminal region (OABB01875)"?
The tested species reactivity for this item is "Human, Mouse, Rat". This antibody is predicted to have homology to "Human|Monkey|Mouse|Rat".
-
How long will it take to receive "SLC12A1 Antibody - N-terminal region (OABB01875)"?
This item is available "Domestic: within 1-2 week delivery | International: within 1-2 week delivery".
-
What buffer format is "SLC12A1 Antibody - N-terminal region (OABB01875)" provided in?
This item is provided in "Lyophilized. Each vial contains 4 mg Trehalose, 0.9 mg NaCl and 0.2 mg Na2HPO4.".
Additional format options may be available. For more information please contact info@avivasysbio.com. -
What are other names for "SLC12A1 Antibody - N-terminal region (OABB01875)"?
This target may also be called "BSC1;bumetanide-sensitive sodium-(potassium)-chloride cotransporter 2;kidney-specific Na-K-Cl symporter;Na-K-2Cl cotransporter;NKCC2;NKCC2A variant A;solute carrier family 12 (sodium/potassium/chloride transporter), member 1;solute carrier family 12 (sodium/potassium/chloride transporters), member 1;solute carrier family 12 member 1." in publications.
-
What is the shipping cost for "SLC12A1 Antibody - N-terminal region (OABB01875)"?
The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.
-
What is the guarantee for "SLC12A1 Antibody - N-terminal region (OABB01875)"?
All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.
-
Can I get bulk pricing for "SLC12A1 Antibody - N-terminal region (OABB01875)"?
You can get bulk pricing for this item by going here.
-
What is the molecular weight of the protein?
The molecular weight reported by Uniprot for this item is "121450 MW".
Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics. -
What protocols are available for "SLC12A1 Antibody - N-terminal region (OABB01875)"?
We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.
-
What are positive controls for "SLC12A1"?
We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.
-
What are negative controls for "SLC12A1"?
We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.
-
What other proteins interact with "SLC12A1"?
This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.
-
What biological processes are associated with "SLC12A1"?
This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.
-
What cellular components are associated with "SLC12A1"?
This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.
-
What protein functions are associated with "SLC12A1"?
This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.