SLC12A1 Antibody - N-terminal region : HRP (ARP41388_P050-HRP)

Catalog No: ARP41388_P050-HRP

Size:100ul

Product Info

• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Rabbit
• Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
• Clonality: Polyclonal
• Host: Rabbit
• Conjugation: HRP: Horseradish Peroxidase
• Application: IHC, WB
• Reconstitution and Storage: All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human SLC12A1
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Cow: 100%; Dog: 100%; Guinea Pig: 93%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 100%
• Peptide Sequence: Synthetic peptide located within the following region: NEKKSRGFFNYQASIFAENFGPRFTKGEGFFSVFAIFFPAATGILAGANI
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-SLC12A1 (ARP41388_P050-HRP) antibody is Catalog # AAP41388 (Previous Catalog # AAPP24126)
• Publications:

  Kelsen, S. et al. Heme oxygenase attenuates angiotensin II-mediated superoxide production in cultured mouse thick ascending loop of Henle cells. Am. J. Physiol. Renal Physiol. 295, F1158-65 (2008). WB, Mouse, Rat, Human, Dog, Pig, Horse, Rabbit, Bovine, Guinea pig 18701634

  Stec, D. E. et al. Expression of heme oxygenase-1 in thick ascending loop of henle attenuates angiotensin II-dependent hypertension. J. Am. Soc. Nephrol. 23, 834-41 (2012). WB, Mouse, Rat, Human, Dog, Pig, Horse, Rabbit, Bovine, Guinea pig 22323644

Target Info

• Gene Symbol: SLC12A1
• Gene Full Name: Solute carrier family 12 (sodium/potassium/chloride transporters), member 1
• Alias Symbols: BSC1, NKCC2
• NCBI Gene Id: 6557
• Protein Name: SLC12A1 protein EMBL AAH40138.1
• Description of Target: The sodium-potassium-chloride cotransporter isoform 2 is kidney-specific and is found on the apical membrane of the thick ascending limb of Henle's loop and the macula densa. It accounts for most of the NaCl resorption with the stoichiometry of 1Na:1K:2Cl and is sensitive to such diuretics as furosemide and bumetanide. Some Bartter-like syndromes result from defects in this gene.
• Uniprot ID: Q8IUN5
• Protein Accession #: AAH40138
• Nucleotide Accession #: NM_000338
• Protein Size (# AA): 430
• Molecular Weight: 47kDa
• Protein Interactions: STK39; OXSR1;