SLBP Antibody - middle region : FITC (ARP40657_P050-FITC)

Catalog No: ARP40657_P050-FITC

Size:100ul

Product Info

• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Zebrafish
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.
• Clonality: Polyclonal
• Host: Rabbit
• Conjugation: FITC: Fluorescein Isothiocyanate
• Application: IHC, WB
• Reconstitution and Storage: All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human SLBP
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 93%; Rat: 100%; Zebrafish: 100%
• Peptide Sequence: Synthetic peptide located within the following region: INYGKNTIAYDRYIKEVPRHLRQPGIHPKTPNKFKKYSRRSWDQQIKLWK
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-SLBP (ARP40657_P050-FITC) antibody is Catalog # AAP40657 (Previous Catalog # AAPP10405)
• Sample Type Confirmation:

  SLBP is supported by BioGPS gene expression data to be expressed in HepG2

• Reference: Borchers,C.H., (2006) Proc. Natl. Acad. Sci. U.S.A. 103 (9), 3094-3099

Target Info

• Gene Symbol: SLBP
• Gene Full Name: Stem-loop binding protein
• Alias Symbols: HBP
• NCBI Gene Id: 7884
• Protein Name: Histone RNA hairpin-binding protein
• Description of Target: SLBP binds to the stem-loop structure in replication-dependent histone mRNAs. Histone mRNAs do not contain introns or polyadenylation signals, and are processed by endonucleolytic cleavage. The stem-loop structure is essential for efficient processing but this structure also controls the transport, translation and stability of histone mRNAs. Expression of the protein is regulated during the cell cycle, increasing more than 10-fold during the latter part of G1.This gene encodes a protein that binds to the stem-loop structure in replication-dependent histone mRNAs. Histone mRNAs do not contain introns or polyadenylation signals, and are processed by endonucleolytic cleavage. The stem-loop structure is essential for efficient processing but this structure also controls the transport, translation and stability of histone mRNAs. Expression of the protein is regulated during the cell cycle, increasing more than 10-fold during the latter part of G1.
• Uniprot ID: Q14493
• Protein Accession #: NP_006518
• Nucleotide Accession #: NM_006527
• Protein Size (# AA): 270
• Molecular Weight: 30kDa
• Protein Interactions: UBC; CDK6; CDK4; UPF1; LSM10; ZNF473; USP8; ERI1;