Search Antibody, Protein, and ELISA Kit Solutions

SLBP Antibody - middle region (ARP40657_P050)

100 ul

Regular Price: $319.00

Special Price: $229.00

In Stock
Request Bulk Order Quote

Conjugation Options

ARP40657_P050-FITC Conjugated

ARP40657_P050-HRP Conjugated

ARP40657_P050-Biotin Conjugated

Tested Species Reactivity:
Predicted Species Reactivity:
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rat, Zebrafish
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Replacement Item:
This antibody may replace item sc-101140 from Santa Cruz Biotechnology.
The immunogen is a synthetic peptide directed towards the middle region of human SLBP
Affinity Purified
Predicted Homology Based on Immunogen Sequence:
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 93%; Rat: 100%; Zebrafish: 100%
Complete computational species homology data:
Anti-SLBP (ARP40657_P050)
Peptide Sequence:
Synthetic peptide located within the following region: INYGKNTIAYDRYIKEVPRHLRQPGIHPKTPNKFKKYSRRSWDQQIKLWK
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide:
For anti-SLBP (ARP40657_P050) antibody is Catalog # AAP40657 (Previous Catalog # AAPP10405)
Printable datasheet for anti-SLBP (ARP40657_P050) antibody
Sample Type Confirmation:

SLBP is supported by BioGPS gene expression data to be expressed in HepG2

Target Reference:
Borchers,C.H., (2006) Proc. Natl. Acad. Sci. U.S.A. 103 (9), 3094-3099
Gene Symbol:
Official Gene Full Name:
Stem-loop binding protein
Alias Symbols:
NCBI Gene Id:
Protein Name:
Histone RNA hairpin-binding protein
Description of Target:
SLBP binds to the stem-loop structure in replication-dependent histone mRNAs. Histone mRNAs do not contain introns or polyadenylation signals, and are processed by endonucleolytic cleavage. The stem-loop structure is essential for efficient processing but this structure also controls the transport, translation and stability of histone mRNAs. Expression of the protein is regulated during the cell cycle, increasing more than 10-fold during the latter part of G1.This gene encodes a protein that binds to the stem-loop structure in replication-dependent histone mRNAs. Histone mRNAs do not contain introns or polyadenylation signals, and are processed by endonucleolytic cleavage. The stem-loop structure is essential for efficient processing but this structure also controls the transport, translation and stability of histone mRNAs. Expression of the protein is regulated during the cell cycle, increasing more than 10-fold during the latter part of G1.
Swissprot Id:
Protein Accession #:
Nucleotide Accession #:
Protein Size (# AA):
Molecular Weight:
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express SLBP.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express SLBP.
Protein Interactions:
UBC; CDK6; CDK4; UPF1; LSM10; ZNF473; USP8; ERI1;

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...