SLAMF7 Antibody - middle region (ARP81538_P050)

Catalog No: ARP81538_P050

Host: Rabbit
Target Name: SLAMF7
Sample Tissue: Human THP-1 Whole Cell lysates
Antibody Dilution: 1ug/ml

Product Info

• Tested Species Reactivity: Human
• Predicted Species Reactivity: Human
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human SLAMF7
• Purification: Affinity purified
• Peptide Sequence: Synthetic peptide located within the following region: QNRNRERVDFPDGGYSLKLSKLKKNDSGIYYVGIYSSSLQQPSTQEYVLH
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-SLAMF7 (ARP81538_P050) antibody is Catalog # AAP81538

Target Info

• Gene Symbol: SLAMF7
• Gene Full Name: SLAM family member 7
• Alias Symbols: 19A, CS1, CD319, CRACC
• NCBI Gene Id: 57823
• Protein Name: SLAM family member 7
• Description of Target: Self-ligand receptor of the signaling lymphocytic activation molecule (SLAM) family. SLAM receptors triggered by homo- or heterotypic cell-cell interactions are modulating the activation and differentiation of a wide variety of immune cells and thus are involved in the regulation and interconnection of both innate and adaptive immune response. Activities are controlled by presence or absence of small cytoplasmic adapter proteins, SH2D1A/SAP and/or SH2D1B/EAT-2. Isoform 1 mediates NK cell activation through a SH2D1A-independent extracellular signal-regulated ERK-mediated pathway. Positively regulates NK cell functions by a mechanism dependent on phosphorylated SH2D1B. Downstream signaling implicates PLCG1, PLCG2 and PI3K. In addition to heterotypic NK cells-target cells interactions also homotypic interactions between NK cells may contribute to activation. However, in the absence of SH2D1B, inhibits NK cell function. Acts also inhibitory in T-cells. May play a role in lymphocyte adhesion. In LPS-activated monocytes negatively regulates production of proinflammatory cytokines.
• Uniprot ID: Q9NQ25-5
• Protein Accession #: NP_067004.3
• Nucleotide Accession #: NM_001282588.1
• Protein Size (# AA): 296
• Molecular Weight: 32 kDa