Search Antibody, Protein, and ELISA Kit Solutions

SLA2 Antibody - N-terminal region (ARP60508_P050)

100 ul
$289.00
In Stock
Request Bulk Order Quote

Conjugation Options

ARP60508_P050-FITC Conjugated

ARP60508_P050-HRP Conjugated

ARP60508_P050-Biotin Conjugated

Gene Symbol:
SLA2
Official Gene Full Name:
Src-like-adaptor 2
NCBI Gene Id:
84174
Protein Name:
Src-like-adapter 2
Swissprot Id:
Q9H6Q3
Protein Accession #:
NP_115590
Nucleotide Accession #:
NM_032214
Alias Symbols:
C20orf156, FLJ21992, MGC49845, SLAP-2, SLAP2, MARS
Replacement Item:
This antibody may replace item sc-115917 from Santa Cruz Biotechnology.
Description of Target:
This gene encodes a member of the SLAP family of adapter proteins. The encoded protein may play an important receptor-proximal role in downregulating T and B cell-mediated responses and inhibits antigen receptor-induced calcium mobilization. This protein interacts with Cas-Br-M (murine) ecotropic retroviral transforming sequence c.
Protein Size (# AA):
261
Molecular Weight:
28kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity Purified
Application:
WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express SLA2.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express SLA2.
Immunogen:
The immunogen is a synthetic peptide directed towards the N terminal region of human SLA2
Predicted Species Reactivity:
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Tested Species Reactivity:
Human
Predicted Homology Based on Immunogen Sequence:
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 93%; Rat: 100%; Zebrafish: 79%
Complete computational species homology data:
Anti-SLA2 (ARP60508_P050)
Peptide Sequence:
Synthetic peptide located within the following region: GDWWTVLSEVSGREYNIPSVHVAKVSHGWLYEGLSREKAEELLLLPGNPG
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
ERBB2; ALB; UBC; CBL; CD247; ZAP70; LAMC2; CSF1;
Blocking Peptide:
For anti-SLA2 (ARP60508_P050) antibody is Catalog # AAP60508 (Previous Catalog # AAPP46804)
Datasheets/Manuals:
Printable datasheet for anti-SLA2 (ARP60508_P050) antibody

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...