SLA2 Antibody - N-terminal region (ARP60508_P050)

Catalog No: ARP60508_P050

WB Suggested Anti-SLA2 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:1562500
Positive Control: Jurkat cell lysate

Product Info

• Tested Species Reactivity: Human
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human SLA2
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 93%; Rat: 100%; Zebrafish: 79%
• Peptide Sequence: Synthetic peptide located within the following region: GDWWTVLSEVSGREYNIPSVHVAKVSHGWLYEGLSREKAEELLLLPGNPG
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-SLA2 (ARP60508_P050) antibody is Catalog # AAP60508 (Previous Catalog # AAPP46804)

Target Info

• Gene Symbol: SLA2
• Gene Full Name: Src-like-adaptor 2
• Alias Symbols: MARS, SLAP2, SLAP-2, C20orf156
• NCBI Gene Id: 84174
• Protein Name: Src-like-adapter 2
• Description of Target: This gene encodes a member of the SLAP family of adapter proteins. The encoded protein may play an important receptor-proximal role in downregulating T and B cell-mediated responses and inhibits antigen receptor-induced calcium mobilization. This protein interacts with Cas-Br-M (murine) ecotropic retroviral transforming sequence c.
• Uniprot ID: Q9H6Q3
• Protein Accession #: NP_115590
• Nucleotide Accession #: NM_032214
• Protein Size (# AA): 261
• Molecular Weight: 28kDa
• Protein Interactions: ERBB2; ALB; UBC; CBL; CD247; ZAP70; LAMC2; CSF1;