SKP2 Antibody - middle region (ARP80621_P050)

Catalog No: ARP80621_P050

Host: Rabbit
Target Name: SKP2
Sample Tissue: Human HT1080 Whole Cell lysates
Antibody Dilution: 1ug/ml

Product Info

• Tested Species Reactivity: Human
• Predicted Species Reactivity: Human
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human SKP2
• Purification: Affinity purified
• Peptide Sequence: Synthetic peptide located within the following region: GVSALEKEEPDSENIPQELLSNLGHPESPPRKRLKSKGSDKDFVIVRRPK
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-SKP2 (ARP80621_P050) antibody is Catalog # AAP80621

Target Info

• Gene Symbol: SKP2
• Gene Full Name: S-phase kinase-associated protein 2, E3 ubiquitin protein ligase
• Alias Symbols: p45, FBL1, FLB1, FBXL1
• NCBI Gene Id: 6502
• Protein Name: S-phase kinase-associated protein 2
• Description of Target: This gene encodes a member of the F-box protein family which is characterized by an approximately 40 amino acid motif, the F-box. The F-box proteins constitute one of the four subunits of ubiquitin protein ligase complex called SCFs (SKP1-cullin-F-box), which function in phosphorylation-dependent ubiquitination. The F-box proteins are divided into 3 classes: Fbws containing WD-40 domains, Fbls containing leucine-rich repeats, and Fbxs containing either different protein-protein interaction modules or no recognizable motifs. The protein encoded by this gene belongs to the Fbls class; in addition to an F-box, this protein contains 10 tandem leucine-rich repeats. This protein is an essential element of the cyclin A-CDK2 S-phase kinase. It specifically recognizes phosphorylated cyclin-dependent kinase inhibitor 1B (CDKN1B, also referred to as p27 or KIP1) predominantly in S phase and interacts with S-phase kinase-associated protein 1 (SKP1 or p19). In addition, this gene is established as a protooncogene causally involved in the pathogenesis of lymphomas. Alternative splicing of this gene generates three transcript variants encoding different isoforms.
• Uniprot ID: Q13309
• Protein Accession #: NP_001230049.1
• Nucleotide Accession #: NM_001243120.1
• Protein Size (# AA): 424
• Molecular Weight: 46 kDa