Skil Antibody - C-terminal region (ARP32370_P050)

Catalog No: ARP32370_P050

WB Suggested Anti-Skil Antibody
Titration: 1.0 ug/ml
Positive Control: Rat Liver

Product Info

• Tested Species Reactivity: Rat
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Yeast
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Cow: 100%; Dog: 93%; Guinea Pig: 100%; Horse: 93%; Human: 100%; Mouse: 93%; Rabbit: 93%; Rat: 100%; Yeast: 82%
• Peptide Sequence: Synthetic peptide located within the following region: LQKKQQLQMEVEMLSSSKAMKELTEEQQNLQKELESLQNEHAQRMEEFYI
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-Skil (ARP32370_P050) antibody is Catalog # AAP32370

Target Info

• Gene Symbol: Skil
• Gene Full Name: SKI-like oncogene
• Alias Symbols: Sno, Skir
• NCBI Gene Id: 114208
• Protein Name: Protein Skil Ensembl ENSRNOP00000013191
• Description of Target: Skil is a glucocorticoid-regulated gene.
• Uniprot ID: D3ZWL1
• Protein Accession #: XP_001057072
• Nucleotide Accession #: XM_001057072
• Protein Size (# AA): 677
• Molecular Weight: 74kDa
• Protein Interactions: Smurf2; Rnf111;