Search Antibody, Protein, and ELISA Kit Solutions

SKI Antibody - middle region (ARP88021_P050)

100 ul
$289.00
In Stock
Request Bulk Order Quote

Gene Symbol:
SKI
Official Gene Full Name:
SKI proto-oncogene
NCBI Gene Id:
6497
Protein Name:
ski oncogene
Swissprot Id:
P12755
Protein Accession #:
NP_003027.1
Nucleotide Accession #:
NM_003036.3
Alias Symbols:
SGS, SKV
Description of Target:
This gene encodes the nuclear protooncogene protein homolog of avian sarcoma viral (v-ski) oncogene. It functions as a repressor of TGF-beta signaling, and may play a role in neural tube development and muscle differentiation.
Protein Size (# AA):
728
Molecular Weight:
80 kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity purified
Application:
WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express SKI.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express SKI.
Immunogen:
The immunogen is a synthetic peptide directed towards the middle region of human SKI
Predicted Species Reactivity:
Human
Tested Species Reactivity:
Human
Peptide Sequence:
Synthetic peptide located within the following region: TDDTSSQSPAPSEKDKPSSWLRTLAGSSNKSLGCVHPRQRLSAFRPWSPA
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide:
For anti-SKI (ARP88021_P050) antibody is Catalog # AAP88021
Datasheets/Manuals:
Printable datasheet for anti-SKI (ARP88021_P050) antibody

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...