SAVE NOW with 10% off all Recombinant Antibodies Shop Now

Catalog No: ARP55460_P050-Biotin
Size:100ul
Price: $434.00
SKU
ARP55460_P050-Biotin
Availability: Domestic: within 1-2 days delivery | International: 1-2 days
Bulk
Order
Aviva's
Satisfaction
Guarantee
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.

Ska1 Antibody - middle region : Biotin (ARP55460_P050-Biotin)

Click here to learn more about Aviva's By-Request Conjugation Service.
Datasheets/ManualsPrintable datasheet for anti-Ska1 (ARP55460_P050-Biotin) antibody
Product Info
Predicted Species ReactivityHuman, Mouse, Rat, Cow, Dog, Horse, Pig, Rabbit
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer.
ClonalityPolyclonal
HostRabbit
ConjugationBiotin
ApplicationWB
Reconstitution and StorageAll conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceCow: 93%; Dog: 93%; Horse: 86%; Human: 100%; Mouse: 93%; Pig: 79%; Rabbit: 93%; Rat: 93%
Peptide SequenceSynthetic peptide located within the following region: LLNKFELEIQYQEQTNSSLKELCESLREECEDVEHLKEHVPPHLPQVTAT
Concentration0.5 mg/ml
Blocking PeptideFor anti-Ska1 (ARP55460_P050-Biotin) antibody is Catalog # AAP55460
Gene SymbolSka1
Gene Full NameSpindle and kinetochore associated complex subunit 1
Alias SymbolsAV117428, 2810433K01Rik
NCBI Gene Id66468
Protein NameSpindle and kinetochore-associated protein 1
Description of TargetSka1 is a Component of the SKA1 complex, a microtubule-binding subcomplex of the outer kinetochore that is essential for proper chromosome segregation. It is required for timely anaphase onset during mitosis, when chromosomes undergo bipolar attachment on spindle microtubules leading to silencing of the spindle checkpoint. The SKA1 complex is a direct component of the kinetochore-microtubule interface and directly associates with microtubules as oligomeric assemblies. The complex facilitates the processive movement of microspheres along a microtubule in a depolymerization-coupled manner. In the complex, it mediates the interaction with microtubules.
Uniprot IDQ9CPV1
Protein Accession #NP_079857
Nucleotide Accession #NM_025581
Protein Size (# AA)254
Molecular Weight28kDa
  1. What is the species homology for "Ska1 Antibody - middle region : Biotin (ARP55460_P050-Biotin)"?

    The tested species reactivity for this item is "". This antibody is predicted to have homology to "Human, Mouse, Rat, Cow, Dog, Horse, Pig, Rabbit".

  2. How long will it take to receive "Ska1 Antibody - middle region : Biotin (ARP55460_P050-Biotin)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "Ska1 Antibody - middle region : Biotin (ARP55460_P050-Biotin)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "Ska1 Antibody - middle region : Biotin (ARP55460_P050-Biotin)"?

    This target may also be called "AV117428, 2810433K01Rik" in publications.

  5. What is the shipping cost for "Ska1 Antibody - middle region : Biotin (ARP55460_P050-Biotin)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "Ska1 Antibody - middle region : Biotin (ARP55460_P050-Biotin)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "Ska1 Antibody - middle region : Biotin (ARP55460_P050-Biotin)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "28kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "Ska1 Antibody - middle region : Biotin (ARP55460_P050-Biotin)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "SKA1"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "SKA1"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "SKA1"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "SKA1"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "SKA1"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "SKA1"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:Ska1 Antibody - middle region : Biotin (ARP55460_P050-Biotin)
Your Rating
We found other products you might like!