Search Antibody, Protein, and ELISA Kit Solutions

SIRT6 antibody - N-terminal region (ARP32409_T100)

100 ul
In Stock
Request Bulk Order Quote

Conjugation Options

ARP32409_T100-FITC Conjugated

ARP32409_T100-HRP Conjugated

ARP32409_T100-Biotin Conjugated

Gene Symbol:
NCBI Gene Id:
Official Gene Full Name:
Sirtuin 6
Protein Name:
NAD-dependent protein deacetylase sirtuin-6
Swissprot Id:
Protein Accession #:
Nucleotide Accession #:
Alias Symbols:
Replacement Item:
This antibody may replace item sc-517196 from Santa Cruz Biotechnology.
Description of Target:
SIRT6 encodes a member of the sirtuin family of proteins, homologs to the yeast Sir2 protein. Studies suggest that the human sirtuins may function as intracellular regulatory proteins with mono-ADP-ribosyltransferase activity. The protein encoded by SIRT6 is included in class IV of the sirtuin family.
Protein Size (# AA):
Molecular Weight:
Protein A purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express SIRT6.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express SIRT6.
The immunogen is a synthetic peptide directed towards the N terminal region of human SIRT6
Tested Species Reactivity:
Human, Mouse
Predicted Homology Based on Immunogen Sequence:
Cow: 92%; Dog: 100%; Guinea Pig: 93%; Horse: 92%; Human: 100%; Mouse: 100%; Pig: 100%; Rat: 100%
Complete computational species homology data:
Anti-SIRT6 (ARP32409_T100)
Peptide Sequence:
Synthetic peptide located within the following region: STASGIPDFRGPHGVWTMEERGLAPKFDTTFESARPTQTHMALVQLERVG
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
Blocking Peptide:
For anti-SIRT6 (ARP32409_T100) antibody is Catalog # AAP32409 (Previous Catalog # AAPP03404)
Printable datasheet for anti-SIRT6 (ARP32409_T100) antibody
Target Reference:
Frye,R.A., (2000) Biochem Biophys Res Commun. 273(2), 793-8

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...