SIRT3 Antibody - N-terminal region : FITC (ARP74220_P050-FITC)

Catalog No: ARP74220_P050-FITC

Size:100ul

Click here to learn more about Aviva's By-Request Conjugation Service.

Product Info

• Predicted Species Reactivity: Human
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.
• Clonality: Polyclonal
• Host: Rabbit
• Conjugation: FITC: Fluorescein Isothiocyanate
• Application: WB
• Reconstitution and Storage: All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
• Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Human SIR3
• Purification: Affinity Purified
• Peptide Sequence: Synthetic peptide located within the following region: AAAPSFFFSSIKGGRRSISFSVGASSVVGSGGSSDKGKLSLQDVAELIRA
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-SIRT3 (ARP74220_P050-FITC) antibody is Catalog # AAP74220

Target Info

• Gene Symbol: SIRT3
• Gene Full Name: sirtuin 3
• Alias Symbols: SIR2L3
• NCBI Gene Id: 23410
• Protein Name: NAD-dependent protein deacetylase sirtuin-3, mitochondrial
• Description of Target: This gene encodes a member of the sirtuin family of proteins, homologs to the yeast Sir2 protein. Members of the sirtuin family are characterized by a sirtuin core domain and grouped into four classes. The functions of human sirtuins have not yet been determined; however, yeast sirtuin proteins are known to regulate epigenetic gene silencing and suppress recombination of rDNA. Studies suggest that the human sirtuins may function as intracellular regulatory proteins with mono-ADP-ribosyltransferase activity. The protein encoded by this gene is included in class I of the sirtuin family. Two alternatively spliced transcript variants that encode different proteins have been described for this gene.
• Uniprot ID: Q9NTG7
• Protein Accession #: NP_036371
• Protein Size (# AA): 399
• Molecular Weight: 43kDa
• Protein Interactions: SIRT5; SKP2; UBC; HSPD1; CMYA5; PGAP1; RIF1; NCAPD2; HERC2; TTF2; UQCRH; UGDH; HSP90B1; SNTB1; SBF1; HSPA9; HSPA5; HSPA4; HSPA1L; GRN; ATP5B; ATP5A1; SIRT4; tat; XRCC6; FOXO3; DNM1L; PEX5;