SIRT2 Antibody - C-terminal region (ARP32385_P050)

Catalog No: ARP32385_P050

WB Suggested Anti-SIRT2 Antibody Titration: 0.2-1 ug/ml
Positive Control: Human brain

Lanes:
1. 30 ug mouse pancreas extract 2. 30 ug mouse pancreas extract 3. 30 ug mouse pancreas extract
Primary Antibody Dilution:
1:1000
Secondary Antibody:
Anti-rabbit HRP
Secondary Antibody Dilution:
1:2000
Gene Name:
SIRT2
Submitted by:
Dr. Jin Hee Lee, Ph.D., Winthrop-University Hospital

Product Info

• Tested Species Reactivity: Human, Mouse
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Rabbit, Zebrafish
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human SIRT2
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Cow: 93%; Dog: 86%; Guinea Pig: 93%; Human: 100%; Mouse: 93%; Rabbit: 79%; Rat: 93%; Zebrafish: 75%
• Peptide Sequence: Synthetic peptide located within the following region: DVAWLGECDQGCLALAELLGWKKELEDLVRREHASIDAQSGAGVPNPSTS
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-SIRT2 (ARP32385_P050) antibody is Catalog # AAP32385 (Previous Catalog # AAPP03375)
• Reference: Borra,M.T., et al., (2004) Biochemistry 43 (30), 9877-9887

Target Info

• Gene Symbol: SIRT2
• Gene Full Name: Sirtuin 2
• Alias Symbols: SIR2, SIR2L, SIR2L2
• NCBI Gene Id: 22933
• Protein Name: NAD-dependent protein deacetylase sirtuin-2
• Description of Target: SIRT2 is a member of the sirtuin family of proteins, homologs to the yeast Sir2 protein. Members of the sirtuin family are characterized by a sirtuin core domain and grouped into four classes. The functions of human sirtuins have not yet been determined; however, yeast sirtuin proteins are known to regulate epigenetic gene silencing and suppress recombination of rDNA. Studies suggest that the human sirtuins may function as intracellular regulatory proteins with mono-ADP-ribosyltransferase activity. SIRT2 is included in class I of the sirtuin family. Two transcript variants result from alternative splicing of this gene.
• Uniprot ID: Q8IXJ6
• Protein Accession #: NP_085096
• Nucleotide Accession #: NM_030593
• Protein Size (# AA): 352
• Molecular Weight: 40kDa
• Protein Interactions: ACLY; SIRT1; UBC; ING1; EP300; CBLB; CBL; XPO1; CDC20; FZR1; RUNX3; PCK1; FOXO1; HDAC6; tat; RBP1; HIST1H3A; NUDT21; PAPOLA; DNAJB8; DNAJB6; SP140; KAT2B; CDC14B; KAT2A; TUBA4A; HOXA10; TUBB; KRT78; RTN4; PHB2; SPOP; ELL; SARS; GYS1;