Catalog No: AVARP00011_P050
Price: $0.00
SKU
AVARP00011_P050
Availability: Domestic: within 1-2 days delivery | International: 1-2 days
Bulk
Order
Aviva's
Satisfaction
Guarantee
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.
Datasheets/ManualsPrintable datasheet for anti-SIRPA (AVARP00011_P050) antibody
Product Info
Tested Species ReactivityHuman
Predicted Species ReactivityHuman, Mouse, Rat, Cow, Horse, Pig
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationWB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
ImmunogenThe immunogen is a synthetic peptide directed towards the C terminal region of human SIRPA
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceCow: 92%; Horse: 84%; Human: 100%; Mouse: 100%; Pig: 90%; Rat: 90%
Peptide SequenceSynthetic peptide located within the following region: QTSPQPASEDTLTYADLDMVHLNRTPKQPAPKPEPSFSEYASVQVPRK
Concentration0.5 mg/ml
Blocking PeptideFor anti-SIRPA (AVARP00011_P050) antibody is Catalog # AAP30463 (Previous Catalog # AAPP01047)
ReferenceKong,X.N., (2007) J. Exp. Med. 204 (11), 2719-2731
Publications

Prion pathogenesis is unaltered in the absence of SIRPa-mediated "don't-eat-me" signaling. PLoS One. 12, e0177876 (2017). 28545141

Description
Gene SymbolSIRPA
Gene Full NameSignal-regulatory protein alpha
Alias SymbolsBIT, MFR, P84, SIRP, MYD-1, SHPS1, CD172A, PTPNS1
NCBI Gene Id140885
Protein NameTyrosine-protein phosphatase non-receptor type substrate 1
Description of TargetSIRPA is a member of the signal-regulatory-protein (SIRP) family, and also belongs to the immunoglobulin superfamily. SIRP family members are receptor-type transmembrane glycoproteins known to be involved in the negative regulation of receptor tyrosine kinase-coupled signaling processes. This protein can be phosphorylated by tyrosine kinases. The phospho-tyrosine residues of this PTP have been shown to recruit SH2 domain containing tyrosine phosphatases (PTP), and serve as substrates of PTPs. This protein was found to participate in signal transduction mediated by various growth factor receptors. CD47 has been demonstrated to be a ligand for this receptor protein. The protein encoded by this gene is a member of the signal-regulatory-protein (SIRP) family, and also belongs to the immunoglobulin superfamily. SIRP family members are receptor-type transmembrane glycoproteins known to be involved in the negative regulation of receptor tyrosine kinase-coupled signaling processes. This protein can be phosphorylated by tyrosine kinases. The phospho-tyrosine residues of this PTP have been shown to recruit SH2 domain containing tyrosine phosphatases (PTP), and serve as substrates of PTPs. This protein was found to participate in signal transduction mediated by various growth factor receptors. CD47 has been demonstrated to be a ligand for this receptor protein. This gene and its product share very high similarity with several other members of the SIRP family. These related genes are located in close proximity to each other on chromosome 20p13. Multiple alternatively spliced transcript variants have been determined for this gene.
Uniprot IDB2R6C3
Protein Accession #NP_542970
Nucleotide Accession #NM_080792
Protein Size (# AA)504
Molecular Weight52kDa
Protein InteractionsCCDC57; KRT40; TRIM2; TRIM27; KRT31; KRT15; UBC; GRB2; Htt; NOL3; IL1RAP; CD47; PTPN6; PTPN11; JAK2;
  1. What is the species homology for "SIRPA Antibody - C-terminal region (AVARP00011_P050)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Human, Mouse, Rat, Cow, Horse, Pig".

  2. How long will it take to receive "SIRPA Antibody - C-terminal region (AVARP00011_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "SIRPA Antibody - C-terminal region (AVARP00011_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "SIRPA Antibody - C-terminal region (AVARP00011_P050)"?

    This target may also be called "BIT, MFR, P84, SIRP, MYD-1, SHPS1, CD172A, PTPNS1" in publications.

  5. What is the shipping cost for "SIRPA Antibody - C-terminal region (AVARP00011_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "SIRPA Antibody - C-terminal region (AVARP00011_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "SIRPA Antibody - C-terminal region (AVARP00011_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "52kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "SIRPA Antibody - C-terminal region (AVARP00011_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "SIRPA"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "SIRPA"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "SIRPA"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "SIRPA"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "SIRPA"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "SIRPA"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:SIRPA Antibody - C-terminal region (AVARP00011_P050)
Your Rating
We found other products you might like!