Search Antibody, Protein, and ELISA Kit Solutions

SIM2 Antibody - N-terminal region (ARP38551_P050)

100 ul
In Stock
Request Bulk Order Quote

Conjugation Options

ARP38551_P050-FITC Conjugated

ARP38551_P050-HRP Conjugated

ARP38551_P050-Biotin Conjugated

Tested Species Reactivity:
Predicted Species Reactivity:
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Replacement Item:
This antibody may replace item sc-8713 from Santa Cruz Biotechnology.
The immunogen is a synthetic peptide directed towards the N terminal region of human SIM2
Affinity Purified
Predicted Homology Based on Immunogen Sequence:
Cow: 93%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 100%
Complete computational species homology data:
Anti-SIM2 (ARP38551_P050)
Peptide Sequence:
Synthetic peptide located within the following region: MKEKSKNAAKTRREKENGEFYELAKLLPLPSAITSQLDKASIIRLTTSYL
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide:
For anti-SIM2 (ARP38551_P050) antibody is Catalog # AAP38551 (Previous Catalog # AAPP20742)
Printable datasheet for anti-SIM2 (ARP38551_P050) antibody
Target Reference:
Laffin,B., (2008) Mol. Cell. Biol. 28 (6), 1936-1946

Spellman, C., Ahmed, M. M., Dubach, D. & Gardiner, K. J. Expression of trisomic proteins in Down syndrome model systems. Gene 512, 219-225 (2013). WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish 23103828

Gene Symbol:
Official Gene Full Name:
Single-minded homolog 2 (Drosophila)
Alias Symbols:
MGC119447, SIM, bHLHe15, HMC13F06, HMC29C01
NCBI Gene Id:
Protein Name:
Single-minded homolog 2
Description of Target:
SIM1 and SIM2 genes are Drosophila single-minded (sim) gene homologs. The Drosophila sim gene encodes a transcription factor that is a master regulator of fruit fly neurogenesis. SIM2 maps within the so-called Down syndrome chromosomal region. Based on t
Swissprot Id:
Protein Accession #:
Nucleotide Accession #:
Protein Size (# AA):
Molecular Weight:
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express SIM2.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express SIM2.
Protein Interactions:

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...