Search Antibody, Protein, and ELISA Kit Solutions

SIM2 Antibody - middle region : HRP (ARP33297_P050-HRP)

100 ul
In Stock
Request Bulk Order Quote

Conjugation Options

ARP33297_P050 Unconjugated

ARP33297_P050-FITC Conjugated

ARP33297_P050-Biotin Conjugated

Predicted Species Reactivity:
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat
Product Format:
Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Reconstitution and Storage:
All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
Gene Symbol:
Official Gene Full Name:
single-minded homolog 2 (Drosophila)
NCBI Gene Id:
Protein Name:
Single-minded homolog 2
Swissprot Id:
Alias Symbols:
Replacement Item:
This antibody may replace item sc-8713 from Santa Cruz Biotechnology.
Description of Target:
This gene represents a homolog of the Drosophila single-minded (sim) gene, which encodes a transcription factor that is a master regulator of neurogenesis. The encoded protein is ubiquitinated by RING-IBR-RING-type E3 ubiquitin ligases, including the parkin RBR E3 ubiquitin protein ligase. This gene maps within the so-called Down syndrome chromosomal region, and is thus thought to contribute to some specific Down syndrome phenotypes. Alternative splicing of this gene results in multiple transcript variants.
Protein Size (# AA):
Molecular Weight:
Affinity purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express SIM2.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express SIM2.
The immunogen is a synthetic peptide directed towards the middle region of Human SIM2
Predicted Homology Based on Immunogen Sequence:
Cow: 86%; Dog: 93%; Guinea Pig: 79%; Horse: 86%; Human: 100%; Mouse: 91%; Pig: 93%; Rabbit: 92%; Rat: 100%
Complete computational species homology data:
Anti-SIM2 (ARP33297_P050)
Peptide Sequence:
Synthetic peptide located within the following region: VLTEIEYKELQLSLEQVSTAKSQDSWRTALSTSQETRKLVKPKNTKMKTK
0.5 mg/ml
Blocking Peptide:
For anti-SIM2 (ARP33297_P050-HRP) antibody is Catalog # AAP33297
Printable datasheet for anti-SIM2 (ARP33297_P050-HRP) antibody
Target Reference:

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...