Size:100 ul
In Stock
Request Bulk
Order Quote
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email:
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Conjugation Options

ARP33297_P050 Unconjugated

ARP33297_P050-HRP Conjugated

ARP33297_P050-Biotin Conjugated

SIM2 Antibody - middle region : FITC (ARP33297_P050-FITC)

Catalog#: ARP33297_P050-FITC
Domestic: within 1-2 days delivery | International: 1-2 days
More Information
Predicted Species Reactivity Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat
Product Format Liquid. Purified antibody supplied in 1x PBS buffer.
Clonality Polyclonal
Host Rabbit
Conjugation FITC (FAM): Excitation 495 nm/ Emission 520 nm
Application WB
Reconstitution and Storage All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
Replacement Item This antibody may replace item sc-8713 from Santa Cruz Biotechnology.
Immunogen The immunogen is a synthetic peptide directed towards the middle region of Human SIM2
Purification Affinity purified
Predicted Homology Based on Immunogen Sequence Cow: 86%; Dog: 93%; Guinea Pig: 79%; Horse: 86%; Human: 100%; Mouse: 91%; Pig: 93%; Rabbit: 92%; Rat: 100%
Complete computational species homology data Anti-SIM2 (ARP33297_P050)
Peptide Sequence Synthetic peptide located within the following region: VLTEIEYKELQLSLEQVSTAKSQDSWRTALSTSQETRKLVKPKNTKMKTK
Concentration 0.5 mg/ml
Blocking Peptide For anti-SIM2 (ARP33297_P050-FITC) antibody is Catalog # AAP33297
Datasheets/Manuals Printable datasheet for anti-SIM2 (ARP33297_P050-FITC) antibody
Target Reference N/A
Gene Symbol SIM2
Official Gene Full Name single-minded homolog 2 (Drosophila)
Alias Symbols SIM2, BHLHE15,
NCBI Gene Id 6493
Protein Name Single-minded homolog 2
Description of Target This gene represents a homolog of the Drosophila single-minded (sim) gene, which encodes a transcription factor that is a master regulator of neurogenesis. The encoded protein is ubiquitinated by RING-IBR-RING-type E3 ubiquitin ligases, including the parkin RBR E3 ubiquitin protein ligase. This gene maps within the so-called Down syndrome chromosomal region, and is thus thought to contribute to some specific Down syndrome phenotypes. Alternative splicing of this gene results in multiple transcript variants.
Swissprot Id Q14190
Protein Size (# AA) 667
Molecular Weight 73kDa
Tissue Tool Find tissues and cell lines supported by DNA array analysis to express SIM2.
RNA Seq Find tissues and cell lines supported by RNA-seq analysis to express SIM2.
  1. What is the species homology for "SIM2 Antibody - middle region : FITC (ARP33297_P050-FITC)"?

    The tested species reactivity for this item is "". This antibody is predicted to have homology to "Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat".

  2. How long will it take to receive "SIM2 Antibody - middle region : FITC (ARP33297_P050-FITC)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "SIM2 Antibody - middle region : FITC (ARP33297_P050-FITC)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer.".
    Additional format options may be available. For more information please contact

  4. What are other names for "SIM2 Antibody - middle region : FITC (ARP33297_P050-FITC)"?

    This target may also be called "SIM2, BHLHE15, " in publications.

  5. What is the shipping cost for "SIM2 Antibody - middle region : FITC (ARP33297_P050-FITC)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "SIM2 Antibody - middle region : FITC (ARP33297_P050-FITC)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "SIM2 Antibody - middle region : FITC (ARP33297_P050-FITC)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "73kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "SIM2 Antibody - middle region : FITC (ARP33297_P050-FITC)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data tab on the product page.

  10. What are positive controls for "SIM2"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "SIM2"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "SIM2"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "SIM2"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "SIM2"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "SIM2"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:SIM2 Antibody - middle region : FITC (ARP33297_P050-FITC)
Your Rating
We found other products you might like!