Search Antibody, Protein, and ELISA Kit Solutions

SIM2 Antibody - middle region (ARP33297_P050)

100 ul
$289.00
In Stock
Request Bulk Order Quote

Conjugation Options

ARP33297_P050-FITC Conjugated

ARP33297_P050-HRP Conjugated

ARP33297_P050-Biotin Conjugated

Gene Symbol:
SIM2
Official Gene Full Name:
single-minded homolog 2 (Drosophila)
NCBI Gene Id:
6493
Protein Name:
Single-minded homolog 2
Swissprot Id:
Q14190
Alias Symbols:
SIM2, BHLHE15,
Replacement Item:
This antibody may replace item sc-8713 from Santa Cruz Biotechnology.
Description of Target:
This gene represents a homolog of the Drosophila single-minded (sim) gene, which encodes a transcription factor that is a master regulator of neurogenesis. The encoded protein is ubiquitinated by RING-IBR-RING-type E3 ubiquitin ligases, including the parkin RBR E3 ubiquitin protein ligase. This gene maps within the so-called Down syndrome chromosomal region, and is thus thought to contribute to some specific Down syndrome phenotypes. Alternative splicing of this gene results in multiple transcript variants.
Protein Size (# AA):
667
Molecular Weight:
73kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity purified
Application:
WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express SIM2.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express SIM2.
Immunogen:
The immunogen is a synthetic peptide directed towards the middle region of Human SIM2
Predicted Species Reactivity:
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat
Tested Species Reactivity:
Human
Predicted Homology Based on Immunogen Sequence:
Cow: 86%; Dog: 93%; Guinea Pig: 79%; Horse: 86%; Human: 100%; Mouse: 91%; Pig: 93%; Rabbit: 92%; Rat: 100%
Complete computational species homology data:
Anti-SIM2 (ARP33297_P050)
Peptide Sequence:
Synthetic peptide located within the following region: VLTEIEYKELQLSLEQVSTAKSQDSWRTALSTSQETRKLVKPKNTKMKTK
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide:
For anti-SIM2 (ARP33297_P050) antibody is Catalog # AAP33297
Datasheets/Manuals:
Printable datasheet for anti-SIM2 (ARP33297_P050) antibody
Target Reference:
N/A

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...