- Toll Free: 888-880-0001
- Phone: 858-552-6979
- Email: info@avivasysbio.com
- $55: Antibody & Protein in US
- $55 + $25/Kit in US
- Contact us for international orders.
Datasheets/Manuals | Printable datasheet for anti-SIGLEC10 (ARP50160_P050) antibody |
---|
Tested Species Reactivity | Human |
---|---|
Predicted Species Reactivity | Human, Dog |
Product Format | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Clonality | Polyclonal |
Host | Rabbit |
Application | WB |
Reconstitution and Storage | For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human SIGLEC10 |
Purification | Affinity Purified |
Predicted Homology Based on Immunogen Sequence | Dog: 79%; Human: 100% |
Peptide Sequence | Synthetic peptide located within the following region: CHVDFSRKGVSAQRTVRLRVAYAPRDLVISISRDNTPALEPQPQGNVPYL |
Concentration | 0.5 mg/ml |
Blocking Peptide | For anti-SIGLEC10 (ARP50160_P050) antibody is Catalog # AAP50160 (Previous Catalog # AAPY02784) |
Reference | Szafranski,K., Genome Biol. 8 (8), R154 (2007) |
---|---|
Gene Symbol | SIGLEC10 |
Gene Full Name | Sialic acid binding Ig-like lectin 10 |
Alias Symbols | SLG2, PRO940, SIGLEC-10 |
NCBI Gene Id | 89790 |
Protein Name | Sialic acid-binding Ig-like lectin 10 |
Description of Target | SIGLEC10 is a putative adhesion molecule that mediates sialic-acid dependent binding to cells. SIGLEC10 preferentially binds to alpha-2,3- or alpha-2,6-linked sialic acid. The sialic acid recognition site may be masked by cis interactions with sialic acids on the same cell surface. In the immune response, SIGLEC10 may act as an inhibitory receptor upon ligand induced tyrosine phosphorylation by recruiting cytoplasmic phosphatase(s) via their SH2 domain(s) that block signal transduction through dephosphorylation of signaling molecules.SIGLECs are members of the immunoglobulin superfamily that are expressed on the cell surface. Most SIGLECs have 1 or more cytoplasmic immune receptor tyrosine-based inhibitory motifs, or ITIMs. SIGLECs are typically expressed on cells of the innate immune system, with the exception of the B-cell expressed SIGLEC6 (MIM 604405).[supplied by OMIM]. PRIMARYREFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-653 AC008750.9 90495-91147 c 654-760 DA387605.1 391-497 761-2959 AF301007.1 262-2460 2960-3794 AY358337.1 1930-2764 |
Uniprot ID | Q96LC7 |
Protein Accession # | NP_149121 |
Nucleotide Accession # | NM_033130 |
Protein Size (# AA) | 697 |
Molecular Weight | 76kDa |
Protein Interactions | FLNA; PTPN6; |
- Protocol:
- Reconstitution & Storage Instructions
- Western Blotting/Immunoblotting (WB/IB) Protocol
- Immunohistochemistry (IHC) Protocol
- Immunocytochemistry (ICC) Protocol
- Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol
- Blocking Peptide Competition Protocol (BPCP)
- Immunoprecipitation (IP) Protocol
- Antibody Array (AA) Protocol
- Tips Information:
-
See our General FAQ page.
-
What is the species homology for "SIGLEC10 Antibody - middle region (ARP50160_P050)"?
The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Human, Dog".
-
How long will it take to receive "SIGLEC10 Antibody - middle region (ARP50160_P050)"?
This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".
-
What buffer format is "SIGLEC10 Antibody - middle region (ARP50160_P050)" provided in?
This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
Additional format options may be available. For more information please contact info@avivasysbio.com. -
What are other names for "SIGLEC10 Antibody - middle region (ARP50160_P050)"?
This target may also be called "SLG2, PRO940, SIGLEC-10" in publications.
-
What is the shipping cost for "SIGLEC10 Antibody - middle region (ARP50160_P050)"?
The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.
-
What is the guarantee for "SIGLEC10 Antibody - middle region (ARP50160_P050)"?
All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.
-
Can I get bulk pricing for "SIGLEC10 Antibody - middle region (ARP50160_P050)"?
You can get bulk pricing for this item by going here.
-
What is the molecular weight of the protein?
The molecular weight reported by Uniprot for this item is "76kDa".
Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics. -
What protocols are available for "SIGLEC10 Antibody - middle region (ARP50160_P050)"?
We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.
-
What are positive controls for "SIGLEC10"?
We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.
-
What are negative controls for "SIGLEC10"?
We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.
-
What other proteins interact with "SIGLEC10"?
This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.
-
What biological processes are associated with "SIGLEC10"?
This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.
-
What cellular components are associated with "SIGLEC10"?
This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.
-
What protein functions are associated with "SIGLEC10"?
This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.