SHOX Antibody - N-terminal region (ARP33284_P050)

Catalog No: ARP33284_P050

WB Suggested Anti-SHOX Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: Human brain

Product Info

• Tested Species Reactivity: Human
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Zebrafish
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human SHOX
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Cow: 93%; Dog: 100%; Guinea Pig: 82%; Horse: 93%; Human: 100%; Mouse: 82%; Pig: 100%; Rat: 82%; Zebrafish: 90%
• Peptide Sequence: Synthetic peptide located within the following region: EELTAFVSKSFDQKSKDGNGGGGGGGGKKDSITYREVLESGLARSRELGT
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-SHOX (ARP33284_P050) antibody is Catalog # AAP33284 (Previous Catalog # AAPP04326)
• Reference: Messina,M.F., (2008) Horm. Res. 69 (2), 124-128

Target Info

• Gene Symbol: SHOX
• Gene Full Name: Short stature homeobox
• Alias Symbols: SS, GCFX, PHOG, SHOXY
• NCBI Gene Id: 6473
• Protein Name: Short stature homeobox protein
• Description of Target: This gene belongs to the paired homeobox family and is located in the pseudoautosomal region 1 (PAR1) of X and Y chromosomes. Defects in this gene are associated with idiopathic growth retardation and in the short stature phenotype of Turner syndrome patients. This gene is highly conserved across species from mammals to fish to flies.This gene belongs to the paired homeobox family and is located in the pseudoautosomal region 1 (PAR1) of X and Y chromosomes. Defects in this gene are associated with idiopathic growth retardation and in the short stature phenotype of Turner syndrome patients. This gene is highly conserved across species from mammals to fish to flies. Alternatively spliced transcript variants encoding different isoforms have been noted for this gene.
• Uniprot ID: O15266
• Protein Accession #: NP_000442
• Nucleotide Accession #: NM_000451
• Protein Size (# AA): 292
• Molecular Weight: 32kDa
• Protein Interactions: CSNK2A1;