Catalog No: ARP58763_P050
Price: $0.00
Availability: Domestic: within 1-2 days delivery | International: 1-2 days
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.
Datasheets/ManualsPrintable datasheet for anti-SHB (ARP58763_P050) antibody
Product Info
Tested Species ReactivityHuman
Predicted Species ReactivityHuman, Mouse, Rat, Cow, Dog, Rabbit
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
ImmunogenThe immunogen is a synthetic peptide directed towards the N terminal region of human SHB
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceCow: 100%; Dog: 93%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%
Peptide SequenceSynthetic peptide located within the following region: ERPSQPPQAVPQASSAASASCGPATASCFSASSGSLPDDSGSTSDLIRAY
Concentration0.5 mg/ml
Blocking PeptideFor anti-SHB (ARP58763_P050) antibody is Catalog # AAP58763 (Previous Catalog # AAPP38530)
Sample Type Confirmation

SHB is supported by BioGPS gene expression data to be expressed in HepG2

ReferenceKriz,V., (2006) J. Biol. Chem. 281 (45), 34484-34491
Gene SymbolSHB
Gene Full NameSrc homology 2 domain containing adaptor protein B
Alias SymbolsbA3J10.2
NCBI Gene Id6461
Protein NameSH2 domain-containing adapter protein B
Description of TargetSHB is the adapter protein which regulates several signal transduction cascades by linking activated receptors to downstream signaling components. SHB may play a role in angiogenesis by regulating FGFR1, VEGFR2 and PDGFR signaling. SHB may also play a role in T-cell antigen receptor/TCR signaling, interleukin-2 signaling, apoptosis and neuronal cells differentiation by mediating basic-FGF and NGF-induced signaling cascades. SHB may also regulate IRS1 and IRS2 signaling in insulin-producing cells.
Uniprot IDQ15464
Protein Accession #NP_003019
Nucleotide Accession #NM_003028
Protein Size (# AA)509
Molecular Weight55kDa
Protein InteractionsSLC39A1; GRAP2; LAT; LCP2; EPS8; JAK3; IL2RG; KDR; SRC; ZAP70; PDGFRA; PLCG1; PIK3R1; VAV1; CRK; JAK1; IL2RB; GRB2; FGFR1; PDGFRB;
  1. What is the species homology for "SHB Antibody - N-terminal region (ARP58763_P050)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Human, Mouse, Rat, Cow, Dog, Rabbit".

  2. How long will it take to receive "SHB Antibody - N-terminal region (ARP58763_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "SHB Antibody - N-terminal region (ARP58763_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "SHB Antibody - N-terminal region (ARP58763_P050)"?

    This target may also be called "bA3J10.2" in publications.

  5. What is the shipping cost for "SHB Antibody - N-terminal region (ARP58763_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "SHB Antibody - N-terminal region (ARP58763_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "SHB Antibody - N-terminal region (ARP58763_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "55kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "SHB Antibody - N-terminal region (ARP58763_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "SHB"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "SHB"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "SHB"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "SHB"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "SHB"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "SHB"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:SHB Antibody - N-terminal region (ARP58763_P050)
Your Rating
We found other products you might like!