- Tested Species Reactivity:
- Mouse
- Predicted Species Reactivity:
- Mouse
- Product Format:
- Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
- Clonality:
- Polyclonal
- Host:
- Rabbit
- Application:
- WB
- Reconstitution and Storage:
- For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
- Gene Symbol:
- SHB
- Official Gene Full Name:
- src homology 2 domain-containing transforming protein B
- NCBI Gene Id:
- 230126
- Protein Name:
- SH2 domain-containing adapter protein B
- Swissprot Id:
- Q6PD21-2
- Protein Accession #:
- NP_001028478.1
- Nucleotide Accession #:
- NM_001033306.1
- Alias Symbols:
- BC028832
- Description of Target:
- Adapter protein which regulates several signal transduction cascades by linking activated receptors to downstream signaling components. May play a role in angiogenesis by regulating FGFR1, VEGFR2 and PDGFR signaling. May also play a role in T-cell antigen receptor/TCR signaling, interleukin-2 signaling, apoptosis and neuronal cells differentiation by mediating basic-FGF and NGF-induced signaling cascades. May also regulate IRS1 and IRS2 signaling in insulin-producing cells (By similarity).
- Protein Size (# AA):
- 217
- Molecular Weight:
- 23 kDa
- Purification:
- Affinity purified
- Tissue Tool:
- Find tissues and cell lines supported by DNA array analysis to express SHB.
- RNA Seq:
- Find tissues and cell lines supported by RNA-seq analysis to express SHB.
- Immunogen:
- The immunogen is a synthetic peptide directed towards the middle region of mouse SHB
- Peptide Sequence:
- Synthetic peptide located within the following region: LPQDDDRPADEYDQPWEWNRVTIPALAAQFNGNEKRQSSPSPSRDRRRQL
- Concentration:
- Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
- Blocking Peptide:
- For anti-SHB (ARP89547_P050) antibody is Catalog # AAP89547
- Datasheets/Manuals:
- Printable datasheet for anti-SHB (ARP89547_P050) antibody
Product Reviews
- Protocol:
- Tips Information:
See our General FAQ page.
