SHB Antibody - middle region (ARP89547_P050)

Catalog#: ARP89547_P050

• Size: 100 ul

• Gene Symbol: SHB
• Official Gene Full Name: src homology 2 domain-containing transforming protein B
• NCBI Gene Id: 230126
• Protein Name: SH2 domain-containing adapter protein B
• Swissprot Id: Q6PD21-2
• Protein Accession #: NP_001028478.1
• Nucleotide Accession #: NM_001033306.1
• Alias Symbols: BC028832
• Description of Target: Adapter protein which regulates several signal transduction cascades by linking activated receptors to downstream signaling components. May play a role in angiogenesis by regulating FGFR1, VEGFR2 and PDGFR signaling. May also play a role in T-cell antigen receptor/TCR signaling, interleukin-2 signaling, apoptosis and neuronal cells differentiation by mediating basic-FGF and NGF-induced signaling cascades. May also regulate IRS1 and IRS2 signaling in insulin-producing cells (By similarity).
• Protein Size (# AA): 217
• Molecular Weight: 23 kDa
• Host: Rabbit
• Clonality: Polyclonal
• Purification: Affinity purified
• Application: WB
• RNA Seq: Find tissues and cell lines supported by RNA-seq analysis to express SHB.
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of mouse SHB
• Predicted Species Reactivity: Mouse
• Tested Species Reactivity: Mouse
• Peptide Sequence: Synthetic peptide located within the following region: LPQDDDRPADEYDQPWEWNRVTIPALAAQFNGNEKRQSSPSPSRDRRRQL
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Concentration: Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
• Blocking Peptide: For anti-SHB (ARP89547_P050) antibody is Catalog # AAP89547

Protocol:

• Reconstitution Instructions
• Immunohistochemistry (IHC) Protocol
• Immunocytochemistry (ICC) Protocol
• Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol
• Western Blotting/Immunoblotting (WB/IB) Protocol
• Blocking Peptide Competition Protocol (BPCP)
• Immunoprecipitation (IP) Protocol

Tips Information:

• IHC Tips & Tricks
• ICC Tips & Tricks
• ELISA Tips & Tricks
• WB/IB Tips & Tricks
• IP Tips & Tricks

See our General FAQ page.