Search Antibody, Protein, and ELISA Kit Solutions

SHB Antibody - middle region (ARP89547_P050)

100 ul
$289.00
In Stock
Request Bulk Order Quote

Gene Symbol:
SHB
Official Gene Full Name:
src homology 2 domain-containing transforming protein B
NCBI Gene Id:
230126
Protein Name:
SH2 domain-containing adapter protein B
Swissprot Id:
Q6PD21-2
Protein Accession #:
NP_001028478.1
Nucleotide Accession #:
NM_001033306.1
Alias Symbols:
BC028832
Description of Target:
Adapter protein which regulates several signal transduction cascades by linking activated receptors to downstream signaling components. May play a role in angiogenesis by regulating FGFR1, VEGFR2 and PDGFR signaling. May also play a role in T-cell antigen receptor/TCR signaling, interleukin-2 signaling, apoptosis and neuronal cells differentiation by mediating basic-FGF and NGF-induced signaling cascades. May also regulate IRS1 and IRS2 signaling in insulin-producing cells (By similarity).
Protein Size (# AA):
217
Molecular Weight:
23 kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity purified
Application:
WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express SHB.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express SHB.
Immunogen:
The immunogen is a synthetic peptide directed towards the middle region of mouse SHB
Predicted Species Reactivity:
Mouse
Tested Species Reactivity:
Mouse
Peptide Sequence:
Synthetic peptide located within the following region: LPQDDDRPADEYDQPWEWNRVTIPALAAQFNGNEKRQSSPSPSRDRRRQL
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide:
For anti-SHB (ARP89547_P050) antibody is Catalog # AAP89547
Datasheets/Manuals:
Printable datasheet for anti-SHB (ARP89547_P050) antibody

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...