Search Antibody, Protein, and ELISA Kit Solutions

SH3GLB1 Antibody - C-terminal region : FITC (ARP73211_P050-FITC)

100 ul
$289.00
In Stock
Request Bulk Order Quote

Conjugation Options

ARP73211_P050 Unconjugated

ARP73211_P050-HRP Conjugated

ARP73211_P050-Biotin Conjugated

Gene Symbol:
SH3GLB1
NCBI Gene Id:
51100
Swissprot Id:
Q9Y371
Protein Accession #:
NP_057093
Alias Symbols:
SH3GLB1, KIAA0491, CGI-61,
Replacement Item:
This antibody may replace item sc-120038 from Santa Cruz Biotechnology.
Description of Target:
This gene encodes a SRC homology 3 domain-containing protein. The encoded protein interacts with the proapoptotic member of the Bcl-2 family, Bcl-2-associated X protein (Bax) and may be involved in regulating apoptotic signaling pathways. This protein may also be involved in maintaining mitochondrial morphology. Alternate splicing results in multiple transcript variants.
Protein Size (# AA):
365
Molecular Weight:
40kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity Purified
Application:
WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express SH3GLB1.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express SH3GLB1.
Immunogen:
The immunogen is a synthetic peptide directed towards the C-terminal region of Human SH3GLB1
Predicted Species Reactivity:
Human
Peptide Sequence:
Synthetic peptide located within the following region: RVLYDYDAANSTELSLLADEVITVFSVVGMDSDWLMGERGNQKGKVPITY
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer.
Reconstitution and Storage:
All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
Concentration:
0.5 mg/ml
Protein Interactions:
FUNDC1; CMTM5; ZNF576; SH3GLB2; SH3GLB1; TFIP11; UBC; TPD52L2; PSMA1; AARSD1; P3H1; NIF3L1; THG1L; NSUN2; LAP3; TPRKB; KIAA1279; HSPBP1; ARPC1A; ARPC2; ACTR2; ACTR3; ARPC4; SH3GL1; RPA2; RANGAP1; PRKACA; PPP2R5D; LPP; AGFG1; CALU; CALR; GADD45G; GADD45A;
Blocking Peptide:
For anti-SH3GLB1 (ARP73211_P050-FITC) antibody is Catalog # AAP73211
Datasheets/Manuals:
Printable datasheet for anti-SH3GLB1 (ARP73211_P050-FITC) antibody
Conjugation:
FITC (FAM): Excitation 495 nm/ Emission 520 nm

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...