Aviva Systems Biology office will be closed for Christmas and New Year Holiday - December 24-25, 2018 and January 1, 2019.
Please go here for more info.

Now Offering Over 102,157 Antibodies & 44,722 Antigens!

SH3BGRL antibody - middle region (ARP48218_P050)

100 ul
$319.00
In Stock

Conjugation Options

ARP48218_P050-FITC Conjugated

ARP48218_P050-HRP Conjugated

ARP48218_P050-Biotin Conjugated

Gene Symbol:
SH3BGRL
NCBI Gene Id:
6451
Official Gene Full Name:
SH3 domain binding glutamic acid-rich protein like
Protein Name:
SH3 domain-binding glutamic acid-rich-like protein
Swissprot Id:
O75368
Protein Accession #:
NP_003013
Nucleotide Accession #:
NM_003022
Alias Symbols:
MGC117402, SH3BGR
Replacement Item:
This antibody may replace item sc-153433 from Santa Cruz Biotechnology.
Description of Target:
SH3BGRL belongs to the SH3BGR family. Mutations in predicted EVH1-binding domain of SH3BGRL had a modest effect on suppression of v-Rel transformation.
Protein Size (# AA):
114
Molecular Weight:
13kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity Purified
Application:
IHC, WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express SH3BGRL.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express SH3BGRL.
Immunogen:
The immunogen is a synthetic peptide directed towards the middle region of human SH3BGRL
Species Reactivity:
Cow, Dog, Horse, Human, Mouse, Pig, Rabbit, Rat, Zebrafish
Predicted Homology Based on Immunogen Sequence:
Cow: 100%; Dog: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 100%
Complete computational species homology data:
Anti-SH3BGRL (ARP48218_P050)
Peptide Sequence:
Synthetic peptide located within the following region: PQIFNESQYRGDYDAFFEARENNAVYAFLGLTAPPGSKEAEVQAKQQA
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
SCAF4; LXN; NSFL1C; SDHAF2; CD2BP2; STUB1; STAT6; SNRPF; PSMA5; PSMA1; IGBP1; UBC; ERBB2; EGFR;
Blocking Peptide:
For anti-SH3BGRL (ARP48218_P050) antibody is Catalog # AAP48218 (Previous Catalog # AAPS22904)
Datasheets/Manuals:
Printable datasheet for anti-SH3BGRL (ARP48218_P050) antibody
Sample Type Confirmation:

SH3BGRL is strongly supported by BioGPS gene expression data to be expressed in MCF7

Target Reference:
Majid,S.M., (2006) Oncogene 25 (5), 756-768

Tell us what you think about this item!

Write A Review
    Please, wait...