Search Antibody, Protein, and ELISA Kit Solutions

SH3BGRL antibody - middle region (ARP48218_P050)

100 ul
In Stock
Request Bulk Order Quote

Conjugation Options

ARP48218_P050-FITC Conjugated

ARP48218_P050-HRP Conjugated

ARP48218_P050-Biotin Conjugated

Gene Symbol:
NCBI Gene Id:
Official Gene Full Name:
SH3 domain binding glutamic acid-rich protein like
Protein Name:
SH3 domain-binding glutamic acid-rich-like protein
Swissprot Id:
Protein Accession #:
Nucleotide Accession #:
Alias Symbols:
MGC117402, SH3BGR
Replacement Item:
This antibody may replace item sc-153433 from Santa Cruz Biotechnology.
Description of Target:
SH3BGRL belongs to the SH3BGR family. Mutations in predicted EVH1-binding domain of SH3BGRL had a modest effect on suppression of v-Rel transformation.
Protein Size (# AA):
Molecular Weight:
Affinity Purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express SH3BGRL.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express SH3BGRL.
The immunogen is a synthetic peptide directed towards the middle region of human SH3BGRL
Tested Species Reactivity:
Predicted Homology Based on Immunogen Sequence:
Cow: 100%; Dog: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 100%
Complete computational species homology data:
Anti-SH3BGRL (ARP48218_P050)
Peptide Sequence:
Synthetic peptide located within the following region: PQIFNESQYRGDYDAFFEARENNAVYAFLGLTAPPGSKEAEVQAKQQA
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
Blocking Peptide:
For anti-SH3BGRL (ARP48218_P050) antibody is Catalog # AAP48218 (Previous Catalog # AAPS22904)
Printable datasheet for anti-SH3BGRL (ARP48218_P050) antibody
Sample Type Confirmation:

SH3BGRL is strongly supported by BioGPS gene expression data to be expressed in MCF7

Target Reference:
Majid,S.M., (2006) Oncogene 25 (5), 756-768

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...