Size:100 ul
Special Price $229.00 Regular Price $319.00
In Stock
Request Bulk
Order Quote
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email:
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Conjugation Options

ARP48218_P050-FITC Conjugated

ARP48218_P050-HRP Conjugated

ARP48218_P050-Biotin Conjugated

SH3BGRL Antibody - middle region (ARP48218_P050)

Catalog#: ARP48218_P050
Domestic: within 1-2 days delivery | International: 1-2 days
More Information
Tested Species Reactivity Human
Predicted Species Reactivity Cow, Dog, Horse, Human, Mouse, Pig, Rabbit, Rat, Zebrafish
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clonality Polyclonal
Host Rabbit
Application IHC, WB
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Replacement Item This antibody may replace item sc-153433 from Santa Cruz Biotechnology.
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human SH3BGRL
Purification Affinity Purified
Predicted Homology Based on Immunogen Sequence Cow: 100%; Dog: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 100%
Complete computational species homology data Anti-SH3BGRL (ARP48218_P050)
Peptide Sequence Synthetic peptide located within the following region: PQIFNESQYRGDYDAFFEARENNAVYAFLGLTAPPGSKEAEVQAKQQA
Concentration Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide For anti-SH3BGRL (ARP48218_P050) antibody is Catalog # AAP48218 (Previous Catalog # AAPS22904)
Datasheets/Manuals Printable datasheet for anti-SH3BGRL (ARP48218_P050) antibody
Sample Type Confirmation

SH3BGRL is strongly supported by BioGPS gene expression data to be expressed in MCF7

Target Reference Majid,S.M., (2006) Oncogene 25 (5), 756-768
Gene Symbol SH3BGRL
Official Gene Full Name SH3 domain binding glutamic acid-rich protein like
Alias Symbols MGC117402, SH3BGR
NCBI Gene Id 6451
Protein Name SH3 domain-binding glutamic acid-rich-like protein
Description of Target SH3BGRL belongs to the SH3BGR family. Mutations in predicted EVH1-binding domain of SH3BGRL had a modest effect on suppression of v-Rel transformation.
Swissprot Id O75368
Protein Accession # NP_003013
Nucleotide Accession # NM_003022
Protein Size (# AA) 114
Molecular Weight 13kDa
Tissue Tool Find tissues and cell lines supported by DNA array analysis to express SH3BGRL.
RNA Seq Find tissues and cell lines supported by RNA-seq analysis to express SH3BGRL.
  1. What is the species homology for "SH3BGRL Antibody - middle region (ARP48218_P050)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Cow, Dog, Horse, Human, Mouse, Pig, Rabbit, Rat, Zebrafish".

  2. How long will it take to receive "SH3BGRL Antibody - middle region (ARP48218_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "SH3BGRL Antibody - middle region (ARP48218_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact

  4. What are other names for "SH3BGRL Antibody - middle region (ARP48218_P050)"?

    This target may also be called "MGC117402, SH3BGR" in publications.

  5. What is the shipping cost for "SH3BGRL Antibody - middle region (ARP48218_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "SH3BGRL Antibody - middle region (ARP48218_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "SH3BGRL Antibody - middle region (ARP48218_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "13kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "SH3BGRL Antibody - middle region (ARP48218_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data tab on the product page.

  10. What are positive controls for "SH3BGRL"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "SH3BGRL"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "SH3BGRL"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "SH3BGRL"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "SH3BGRL"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "SH3BGRL"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:SH3BGRL Antibody - middle region (ARP48218_P050)
Your Rating