$0.00
In Stock
SKU
OPCA247398
Request Bulk
Order Quote
Aviva's
Satisfaction
Guarantee
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email: info@avivasysbio.com
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

SH_RS05995 Recombinant Protein (Staphylococcus haemolyticus) (OPCA247398)

Catalog#: OPCA247398
Domestic: within 4-6 weeks delivery | International: 4-6 weeks
More Information
Predicted Species Reactivity Staphylococcus haemolyticus
Product Format Liquid
Host E. coli, yeast, insect, or mammalian cell can be selected above to determine price.
Application WB, ELISA
Additional Information For Research Use Only.
Sterile filtering available upon request.
Low endotoxin available upon request.
Reconstitution and Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C. Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Purity Greater than 85% as determined by SDS-PAGE.
Protein Sequence MLDFEKPLFEIKNKIESLKQSQEKNDVDLQDEIDLLEASLERETKKIYTNLKPWDRVQIARLQERPTTLDYIPYIFDSFIELHGDRNFRDDPAMIGGIGYLNGTPVTVIGQQRGKDTKDNIYRNFGMAHPEGYRKALRLMKQAEKFNRPIFTFIDTKGAYPGKAAEERGQSESIARNLVEMASLKVPVIAIVIGEGGSGGALGIGIANRIMMLENSTYSVISPEGAAALLWKDSSLAKMAAETMKITAKDLHHLNVIDSVIDEPLGGAHNNIEQQAIDIKQAFVDQLEQLQQQSADELVEDRFNKFRNIGAFIEK
Storage Buffer Tris-based buffer,50% glycerol
Tag This protein may contain a N-terminal tag or C-terminal tag based on protein stability requirements.
Datasheets/Manuals Printable datasheet for OPCA247398
Gene Symbol SH_RS05995
NCBI Gene Id 24247599
Swissprot Id Q4L741
Protein Size (# AA) 315
Tissue Tool Find tissues and cell lines supported by DNA array analysis to express SH_RS05995.
RNA Seq Find tissues and cell lines supported by RNA-seq analysis to express SH_RS05995.
Write Your Own Review
You're reviewing:SH_RS05995 Recombinant Protein (Staphylococcus haemolyticus) (OPCA247398)
Your Rating