SGMS2 Antibody - N-terminal region (ARP53077_P050)

Catalog No: ARP53077_P050

Click here to learn more about Aviva's By-Request Conjugation Service.

WB Suggested Anti-SGMS2 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: Human heart

Product Info

• Tested Species Reactivity: Human
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human SGMS2
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 93%
• Peptide Sequence: Synthetic peptide located within the following region: KFPLEWWKTGIAFIYAVFNLVLTTVMITVVHERVPPKELSPPLPDKFFDY
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-SGMS2 (ARP53077_P050) antibody is Catalog # AAP53077 (Previous Catalog # AAPP35307)
• Enhanced Validation:

  WB	Y
  SPR
  YCHAROS

Target Info

• Reference: Ding,T., (2008) J. Lipid Res. 49 (2), 376-385
• Gene Symbol: SGMS2
• Gene Full Name: Sphingomyelin synthase 2
• Alias Symbols: CDL, SMS2
• NCBI Gene Id: 166929
• Protein Name: Phosphatidylcholine:ceramide cholinephosphotransferase 2
• Description of Target: SGMS2 is a bidirectional lipid cholinephosphotransferase capable of converting phosphatidylcholine (PC) and ceramide to sphingomyelin (SM) and diacylglycerol (DAG) and vice versa. Direction is dependent on the relative concentrations of DAG and ceramide as phosphocholine acceptors. SGMS2 directly and specifically recognizes the choline head group on the substrate. SGMS2 also requires two fatty chains on the choline-P donor molecule in order to be recognized efficiently as a substrate. SGMS2 does not function strictly as a SM synthase. SGMS2 is required for cell growth.Sphingomyelin (SM) is a major component of plasma membranes. It is preferentially concentrated in the outer leaflet and has a role in the formation of lipid rafts. SM synthases (EC 2.7.8.27), such as SGMS2, produce SM in the lumen of the Golgi and on the cell surface through the transfer of phosphocholine from phosphatidylcholine onto ceramide, yielding diacylglycerol as a side product (Huitema et al., 2004 [PubMed 14685263]).[supplied by OMIM]. Sequence Note: removed 3 bases from the 5' end that did not align to the reference genome assembly. PRIMARYREFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-2142 BC041369.2 4-2145
• Uniprot ID: Q8NHU3
• Protein Accession #: NP_689834
• Nucleotide Accession #: NM_152621
• Protein Size (# AA): 365
• Molecular Weight: 42 kDa
• Protein Interactions: UBC;