Sgms1 Antibody - middle region (ARP55476_P050)

Catalog No: ARP55476_P050

25 ug of the indicated Mouse tissue extracts was loaded onto a 12% SDS-PAGE gel. 3 ug/mL of the antibody was used in this experiment. Peptide is present in 49 kDa, 32 kDa and 25 kDa forms. Protein may be phosphorylated.

WB Suggested Anti-Sgms1 Antibody
Titration: 1.0 ug/ml
Positive Control: Mouse Muscle

Product Info

• Tested Species Reactivity: Mouse
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of Mouse Sgms1
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 77%
• Peptide Sequence: Synthetic peptide located within the following region: LTTVMISVVHERVPPKEVQPPLPDTFFDHFNRVQWAFSICEINGMILVGL
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-Sgms1 (ARP55476_P050) antibody is Catalog # AAP55476
• Enhanced Validation:

  Relative Expression (Western Blot)

• Publications:

  Mass Spectrometry Imaging Reveals Elevated Glomerular ATP/AMP in Diabetes/obesity and Identifies Sphingomyelin as a Possible Mediator. EBioMedicine. 7, 121-34 (2016). 27322466

Target Info

• Gene Symbol: Sgms1
• Alias Symbols: SM, Mob, Sms1, Sor1, SMS1b, SMS1g, C80702, Tmem23, AI841905, 9530058O11Rik
• NCBI Gene Id: 208449
• Protein Name: Phosphatidylcholine:ceramide cholinephosphotransferase 1
• Description of Target: Bidirectional lipid cholinephosphotransferase is capable of converting phosphatidylcholine (PC) and ceramide to sphingomyelin (SM) and diacylglycerol (DAG) and vice versa. Direction is dependent on the relative concentrations of DAG and ceramide as phosphocholine acceptors. Sgms1 directly and specifically recognizes the choline head group on the substrate. It also requires two fatty chains on the choline-P donor molecule in order to be recognized efficiently as a substrate. Sgms1 does not function strictly as a SM synthase and suppresses BAX-mediated apoptosis and also prevents cell death in response to stimuli such as hydrogen peroxide, osmotic stress, elevated temperature and exogenously supplied sphingolipids. Sgms1 may protect against cell death by reversing the stress-inducible increase in levels of proapoptotic ceramide.
• Uniprot ID: Q8VCQ6
• Protein Accession #: NP_659041
• Nucleotide Accession #: NM_144792
• Protein Size (# AA): 419
• Molecular Weight: 49 kDa