SGK3 Antibody - N-terminal region (ARP90569_P050)

Catalog No: ARP90569_P050

Host: Rabbit
Target Name: SGK3
Sample Tissue: Mouse SP2/0 Whole Cell lysates
Antibody Dilution: 1ug/ml

Product Info

• Predicted Species Reactivity: Mouse
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of mouse SGK3
• Purification: Affinity purified
• Peptide Sequence: Synthetic peptide located within the following region: SCPSVSIPSSDEHREKKKRFTVYKVLVSVGRSEWFVFRRYAEFDKLYNSL
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-SGK3 (ARP90569_P050) antibody is Catalog # AAP90569

Target Info

• Gene Symbol: SGK3
• Gene Full Name: serum/glucocorticoid regulated kinase 3
• Alias Symbols: Ci, fy, fz, Cisk, 2510015P22Rik, A330005P07Rik
• NCBI Gene Id: 170755
• Protein Name: serine/threonine-protein kinase Sgk3
• Description of Target: Serine/threonine-protein kinase which is involved in the regulation of a wide variety of ion channels, membrane transporters, cell growth, proliferation, survival and migration. Up-regulates Na+ channels: SCNN1A/ENAC and SCN5A, K+ channels: KCNA3/KV1.3, KCNE1, KCNQ1 and KCNH2/HERG, epithelial Ca2+ channels: TRPV5 and TRPV6, chloride channel: BSND, creatine transporter: SLC6A8, Na+/dicarboxylate cotransporter: SLC13A2/NADC1, Na+-dependent phosphate cotransporter: SLC34A2/NAPI-2B, amino acid transporters: SLC1A5/ASCT2 and SLC6A19, glutamate transporters: SLC1A3/EAAT1, SLC1A6/EAAT4 and SLC1A7/EAAT5, glutamate receptors: GRIA1/GLUR1 and GRIK2/GLUR6, Na+/H+ exchanger: SLC9A3/NHE3, and the Na+/K+ ATPase. Plays a role in the regulation of renal tubular phosphate transport and bone density. Phosphorylates NEDD4L and GSK3B. Positively regulates ER transcription activity through phosphorylation of FLII. Negatively regulates the function of ITCH/AIP4 via its phosphorylation and thereby prevents CXCR4 from being efficiently sorted to lysosomes.
• Uniprot ID: Q9ERE3
• Protein Accession #: NP_001032848.1
• Nucleotide Accession #: NM_001037759.1
• Protein Size (# AA): 496
• Molecular Weight: 54 kDa