Search Antibody, Protein, and ELISA Kit Solutions

SGK1 Antibody - N-terminal region (ARP56652_P050)

100 ul

Regular Price: $319.00

Special Price: $229.00

In Stock
Request Bulk Order Quote

Conjugation Options

ARP56652_P050-FITC Conjugated

ARP56652_P050-HRP Conjugated

ARP56652_P050-Biotin Conjugated

Tested Species Reactivity:
Human, Mouse
Predicted Species Reactivity:
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clonality:
Polyclonal
Host:
Rabbit
Application:
WB, IHC
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Replacement Item:
This antibody may replace item sc-130402 from Santa Cruz Biotechnology.
Immunogen:
The immunogen is a synthetic peptide directed towards the N terminal region of human SGK1
Purification:
Affinity Purified
Predicted Homology Based on Immunogen Sequence:
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 92%
Complete computational species homology data:
Anti-SGK1 (ARP56652_P050)
Peptide Sequence:
Synthetic peptide located within the following region: ANPSPPPSPSQQINLGPSSNPHAKPSDFHFLKVIGKGSFGKVLLARHKAE
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide:
For anti-SGK1 (ARP56652_P050) antibody is Catalog # AAP56652 (Previous Catalog # AAPP39409)
Datasheets/Manuals:
Printable datasheet for anti-SGK1 (ARP56652_P050) antibody
Sample Type Confirmation:

SGK1 is supported by BioGPS gene expression data to be expressed in HepG2

Target Reference:
Pew,T., (2008) Endocrinology 149 (5), 2637-2645
Gene Symbol:
SGK1
Official Gene Full Name:
Serum/glucocorticoid regulated kinase 1
Alias Symbols:
SGK
NCBI Gene Id:
6446
Protein Name:
Serine/threonine-protein kinase Sgk1
Description of Target:
This gene encodes a serine/threonine protein kinase that plays an important role in cellular stress response. This kinase activates certain potassium, sodium, and chloride channels, suggesting an involvement in the regulation of processes such as cell sur
Swissprot Id:
O00141
Protein Accession #:
NP_005618
Nucleotide Accession #:
NM_005627
Protein Size (# AA):
431
Molecular Weight:
49kDa
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express SGK1.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express SGK1.
Protein Interactions:
AKT1S1; YWHAQ; YWHAZ; MAPT; MTOR; CDKN1B; RPTOR; NEDD4L; Tmem109; Rabac1; GADD45G; UBC; MAGEA1; HSP90AA1; TMEM184C; WNK1; WNK2; WNK4; RAF1; PDPK1; NEDD4; TSC22D3; STUB1; HSPA4; ELAVL1; COMMD1; SYVN1; SCNN1B; RICTOR; PDK1; YPK1; IKBKG; CAMKK1; KCNJ1; GSK3A

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...