Search Antibody, Protein, and ELISA Kit Solutions

SGK1 antibody - N-terminal region (ARP56652_P050)

100 ul
In Stock
Request Bulk Order Quote

Conjugation Options

ARP56652_P050-FITC Conjugated

ARP56652_P050-HRP Conjugated

ARP56652_P050-Biotin Conjugated

Gene Symbol:
NCBI Gene Id:
Official Gene Full Name:
Serum/glucocorticoid regulated kinase 1
Protein Name:
Serine/threonine-protein kinase Sgk1
Swissprot Id:
Protein Accession #:
Nucleotide Accession #:
Alias Symbols:
Replacement Item:
This antibody may replace item sc-130402 from Santa Cruz Biotechnology.
Description of Target:
This gene encodes a serine/threonine protein kinase that plays an important role in cellular stress response. This kinase activates certain potassium, sodium, and chloride channels, suggesting an involvement in the regulation of processes such as cell sur
Protein Size (# AA):
Molecular Weight:
Affinity Purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express SGK1.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express SGK1.
The immunogen is a synthetic peptide directed towards the N terminal region of human SGK1
Tested Species Reactivity:
Human, Mouse
Predicted Homology Based on Immunogen Sequence:
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 92%
Complete computational species homology data:
Anti-SGK1 (ARP56652_P050)
Peptide Sequence:
Synthetic peptide located within the following region: ANPSPPPSPSQQINLGPSSNPHAKPSDFHFLKVIGKGSFGKVLLARHKAE
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
Blocking Peptide:
For anti-SGK1 (ARP56652_P050) antibody is Catalog # AAP56652 (Previous Catalog # AAPP39409)
Printable datasheet for anti-SGK1 (ARP56652_P050) antibody
Sample Type Confirmation:

SGK1 is supported by BioGPS gene expression data to be expressed in HepG2

Target Reference:
Pew,T., (2008) Endocrinology 149 (5), 2637-2645

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...