Protein on Demand™ SFTPB Recombinant Protein (Human) (OPCA32776)

Datasheets/Manuals	Printable datasheet for OPCA32776

Product Info
Predicted Species Reactivity	Human
Product Format	Liquid
Application	WB, ELISA
Additional Information	For Research Use Only. Sterile filtering available upon request. Low endotoxin available upon request.
Reconstitution and Storage	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C. Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Purity	Greater than 85% as determined by SDS-PAGE.
Protein Sequence	FPIPLPYCWLCRALIKRIQAMIPKGALAVAVAQVCRVVPLVAGGICQCLAERYSVILLDTLLGRMLPQLVCRLVLRCSM
Storage Buffer	Tris-based buffer,50% glycerol
Protein Range	201-279

Gene Full Name	surfactant protein B
Alias Symbols	SP-B, PSP-B, SFTB3, SFTP3, SMDP1
NCBI Gene Id	6439
Protein Name	pulmonary surfactant-associated protein B
Description of Target	This gene encodes the pulmonary-associated surfactant protein B (SPB), an amphipathic surfactant protein essential for lung function and homeostasis after birth. Pulmonary surfactant is a surface-active lipoprotein complex composed of 90% lipids and 10% p
Uniprot ID	P07988
Protein Accession #	NP_000533.3
Nucleotide Accession #	NM_000542.3
Protein Size (# AA)	79