Catalog No: OPCA32776
Price: $0.00
SKU
OPCA32776
Availability: Domestic: within 4-8 weeks delivery International: 4-8 weeks
Contact Us:
- Toll Free: 888-880-0001
- Phone: 858-552-6979
- Email: info@avivasysbio.com
Shipping Info:
- $55: Antibody & Protein in US
- $55 + $25/Kit in US
- Contact us for international orders.
Protein on Demand™ SFTPB Recombinant Protein (Human) (OPCA32776)
Datasheets/Manuals | Printable datasheet for OPCA32776 |
---|
Predicted Species Reactivity | Human |
---|---|
Product Format | Liquid |
Application | WB, ELISA |
Additional Information | For Research Use Only. Sterile filtering available upon request. Low endotoxin available upon request. |
Reconstitution and Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C. Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week. |
Purity | Greater than 85% as determined by SDS-PAGE. |
Protein Sequence | FPIPLPYCWLCRALIKRIQAMIPKGALAVAVAQVCRVVPLVAGGICQCLAERYSVILLDTLLGRMLPQLVCRLVLRCSM |
Storage Buffer | Tris-based buffer,50% glycerol |
Protein Range | 201-279 |
Gene Full Name | surfactant protein B |
---|---|
Alias Symbols | SP-B, PSP-B, SFTB3, SFTP3, SMDP1 |
NCBI Gene Id | 6439 |
Protein Name | pulmonary surfactant-associated protein B |
Description of Target | This gene encodes the pulmonary-associated surfactant protein B (SPB), an amphipathic surfactant protein essential for lung function and homeostasis after birth. Pulmonary surfactant is a surface-active lipoprotein complex composed of 90% lipids and 10% p |
Uniprot ID | P07988 |
Protein Accession # | NP_000533.3 |
Nucleotide Accession # | NM_000542.3 |
Protein Size (# AA) | 79 |
Write Your Own Review