SFTPB Recombinant Protein (Human) (OPCA05381)

Catalog No: OPCA05381

Product Info

• Predicted Species Reactivity: Homo sapiens|Human
• Product Format: Liquid or Lyophilized powder
• Additional Information: Species Specificity Detail: Homo sapiens (Human)
• Reconstitution and Storage: -20°C or -80°C
• Formulation: Tris-base, 50% glycerol
• Purity: Greater than 90% as determined by SDS-PAGE.
• Peptide Sequence: FPIPLPYCWLCRALIKRIQAMIPKGALAVAVAQVCRVVPLVAGGICQCLAERYSVILLDTLLGRMLPQLVCRLVLRCSM
• Protein Sequence: FPIPLPYCWLCRALIKRIQAMIPKGALAVAVAQVCRVVPLVAGGICQCLAERYSVILLDTLLGRMLPQLVCRLVLRCSM
• Storage Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Source: E.coli
• Protein Range: 201-279 aa
• Tag: N-terminal 6xHis-SUMO-tagged
• Reference: cDNA and deduced amino acid sequence of human pulmonary surfactant-associated proteolipid SPL(Phe). Glasser S.W., Korfhagen T.R., Weaver T., Pilot-Matias T., Fox J.L., Whitsett J.A. Proc. Natl. Acad. Sci. U.S.A. 84:4007-4011(1987)

Target Info

• Gene Symbol: SFTPB
• Gene Full Name: surfactant protein B
• Alias Symbols: 18 kDa pulmonary-surfactant protein;6 kDa protein;PSP-B;pulmonary surfactant-associated protein B;pulmonary surfactant-associated proteolipid SPL(Phe);SFTB3;SFTP3;SMDP1;SP-B.
• NCBI Gene Id: 6439
• Protein Name: Pulmonary surfactant-associated protein B
• Description of Target: Pulmonary surfactant-associated proteins promote alveolar stability by lowering the surface tension at the air-liquid interface in the peripheral air spaces. SP-B increases the collapse pressure of palmitic acid to nearly 70 millinewtons per meter.
• Uniprot ID: P07988
• Protein Accession #: NP_000533
• Nucleotide Accession #: NM_000542
• Protein Size (# AA): Recombinant
• Molecular Weight: 24.7 kDa