Search Antibody, Protein, and ELISA Kit Solutions

SFTPA2 antibody - N-terminal region (ARP64034_P050)

100 ul
$289.00
In Stock
Request Bulk Order Quote

Conjugation Options

ARP64034_P050-FITC Conjugated

ARP64034_P050-HRP Conjugated

ARP64034_P050-Biotin Conjugated

Gene Symbol:
SFTPA2
NCBI Gene Id:
729238
Official Gene Full Name:
Surfactant protein A2
Protein Name:
Pulmonary surfactant-associated protein A2
Swissprot Id:
Q8IWL1
Protein Accession #:
NP_001092138
Nucleotide Accession #:
NM_001098668
Alias Symbols:
COLEC5, FLJ50594, FLJ50597, FLJ51953, FLJ79091, FLJ93678, MGC133169, MGC133366, MGC189714, MGC189761, PSAP, SFTP1, SFTPA2B, SPA2, SPAII
Replacement Item:
This antibody may replace item sc-36535 from Santa Cruz Biotechnology.
Description of Target:
This gene is one of several genes encoding pulmonary-surfactant associated proteins (SFTPA) located on chromosome 10. Mutations in this gene and a highly similar gene located nearby, which affect the highly conserved carbohydrate recognition domain, are associated with idiopathic pulmonary fibrosis. The current version of the assembly displays only a single centromeric SFTPA gene pair rather than the two gene pairs shown in the previous assembly which were thought to have resulted from a duplication.
Protein Size (# AA):
248
Molecular Weight:
26kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity Purified
Application:
WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express SFTPA2.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express SFTPA2.
Tested Species Reactivity:
Human
Predicted Homology Based on Immunogen Sequence:
Cow: 100%; Dog: 92%; Goat: 91%; Guinea Pig: 86%; Horse: 86%; Human: 100%; Mouse: 86%; Pig: 93%; Rabbit: 86%; Rat: 86%; Sheep: 93%; Zebrafish: 85%
Complete computational species homology data:
Anti-SFTPA2 (ARP64034_P050)
Peptide Sequence:
Synthetic peptide located within the following region: PGNNGLPGAPGVPGERGEKGEAGERGPPGLPAHLDEELQATLHDFRHQIL
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
SFTPA2; SFTPA1; CD93;
Blocking Peptide:
For anti-SFTPA2 (ARP64034_P050) antibody is Catalog # AAP64034
Datasheets/Manuals:
Printable datasheet for anti-SFTPA2 (ARP64034_P050) antibody

Product Reviews

Average Rating:
2 reviews
5 star
2
4 star
0
3 star
0
2 star
0
1 star
0
  • Date - Newest First
  • Date - Newest First
  • Date - Latest First
  • Highest Rated
  • Lowest Rated
  • Most Helpful
  • Ownership

2 Item(s)

02/01/2017 16:24
  • Overall Experience:
  • Quality:
Product Review: SFTPA2 antibody-N-terminal region (ARP64034_P050) in Human SP-A samples purified from Human BAL, CHO cell lines, and transgenic mice, rat and mouse BALs, and Human Type II cell extracts using Western blot
Product Page for SFTPA2 antibody-N-terminal region (ARP64034_P050)

Researchers: Dr. Joanna Floros and Todd M. Umstead, Pennsylvania State University College of Medicine

Application: Western blotting
Species + Tissue/Cell type:

1: 20ng human SP-A2 protein,

2: 20ug rat wt BAL cell lysate,

3: 25ng hSP-A2 (1A0) protein purified from transfected CHO lysate,

4: 25ng hSP-A2 (1A1) protein purified from transfected CHO lysate,

5: 25ng hSP-A1 (6A2) protein purified from transfected CHO lysate,

6: 25ng hSP-A1 (6A4) protein purified from transfected CHO lysate,

7: 25ng hSP-A2/1 (1A0/6A4) protein purified from transfected CHO lysate,

8: 25ng hSP-A2/1 (1A1/6A2) protein purified from transfected CHO lysate,

9: 20ug SP-A KO mouse BAL lysate,

10: 25ng hSP-A2 (1A0) protein purified from transfected mouse BAL lysate,

11: 25ng hSP-A2 (1A1) protein purified from transfected mouse BAL lysate,

12: 25ng hSP-A1 (6A2) protein purified from transfected mouse BAL lysate,

13: 25ng hSP-A1 (6A4) protein purified from transfected mouse BAL lysate,

14: 25ng hSP-A2/1 (1A0/6A2) protein purified from transfected mouse BAL lysate,

15: 25ng mouse SP-A2 protein purified from mouse BAL lysate,

16: 20ug mouse wt BAL lysate,

17: 15ug human wt T2 lysate,

18: 25ng human SP-A2 protein.

Primary antibody dilution: 1:2500
Secondary antibody: Goat anti-rabbit-HRP
Secondary antibody dilution: 1:10,000


Questionnaire:
How do Aviva's reagents play a role in your experimental goals? Gives me the ability to detect the amount of SP-A2 in my total SP-A sample.
How would you rate this antibody on a scale from 1-5 (5=best) and why? 5. High sensitivity, low background and little cross reactivity with other proteins including hSP-A1.
Would you use this antibody in future experiments? Yes
Have you used another antibody which has worked in your application? Yes
Do you believe the information about the reagent on Aviva's website is correct? Yes
If the antibody works, do you plan to use it in future experiments or to publish your data? Why or why not? Yes, and I have already purchased a second aliquot of the SFTPA2 antibody to use for Western blots and ELISA
How did you store the antibody after re-suspension? Aliquoted at -20C.
Sample Description (please include 1) species type, and 2) cell/tissue type, and 3) how much protein loaded for each lane of your gel): Human SP-A samples purified from Human BAL, CHO cell lines, and transgenic mice (25ng/lane), rat and mouse BALs (12.5uL/lane, protein content unknown), and Human Type II cell extracts (10uL/lane, protein content unknown).
How many different experimental trials were conducted using the antibody sample? One
How was this sample prepared? Samples were lyophilized and resuspended in Laemmli Buffer.
Primary antibody dilution and incubation time: 1:2,500 (0.4ug/mL) for 2hrs.
Secondary antibody used and dilution and incubation time: 1:10,000 Bio-Rad GAR IgG HRP Conj for 1hr
What controls were used in your experiment (positive/negative)? Positive controls included Human SP-A samples as well as variants of hSP-A2 (1A0 and 1A1) expressed in CHO cells and transgenic mice. Negative controls included SP-A KO mouse BAL, WT mouse BAL, and variants of hSP-A1 (6A2 and 6A4) expressed in CHO cells and transgenic mice.
Please include your detailed WB Procedure/Protocol here: ExcelGelWestern Enhanced Chemiluminescence (ECL) Protocol Using Aviva SFTPA2 Antibody1. Run desired One or Two-Dimensional ExcelGel following the 2DGEL.PRO protocol.
2. Transfer gel to Bio-Rad Trans-Blot Transfer Medium (Nitrocellulose, 0.45 um) using NovaBlot apparatus for 90 minutes at 250 mA (Pushed by 12 V).
3. Block for 1 hour with 200 mL 1X PBS, 1% Bovine Serum Albumin (BSA) (or overnight).
4. Rinse 2 times with 100 mL 1X PBS, 0.5 % Tween 20.
5. Wash 1 time for 10 minutes with 200 mL 1X PBS, 0.5 % Tween 20.
6. 1st Ab - 1:2,500 Aviva SFTPA2 Antibody in 100 mL 1 % BSA, 0.05% Tween 20, 1X PBS for 2 hours.
7. Rinse 2 times with 100 mL 1X PBS, 0.5 % Tween 20.
8. Wash 3 times 10 minutes with 200 mL 1X PBS, 0.5 % Tween 20.
9. 2nd Ab - 1:10,000 Bio-Rad GAR IgG HRP (conj) in 100 mL 1 % BSA, 0.05% Tween 20, 1X PBS for 1 hour.
10. Rinse 2 times with 100 mL 1X PBS, 0.5 % Tween 20.
11. Wash 3 times 10 minutes with 200 mL 1X PBS, 0.5 % Tween 20.
12. Rinse 1 time with 200 mL 1X PBS (transport to dark room in this solution).
13. ECL develop for 1 minute with 20 mL of each ECL solution (NEN)(get ECL solutions out ahead of time and allow the 20 mL aliquots of each to warm to room temperature before use).
14. Wrap membrane in Saran Wrap and smooth out any extra solution ® tape into an X-ray cassette.
15. Expose to X-ray film for 15 seconds, 1 minute, 2 minutes and 5 minutes ® develop films and determine if additional exposures are needed ® expose and develop.Volumes of solutions for the above steps may vary depending on membrane size…SOLUTIONS5X PBS -To make 4 liters of 5X (pH 7.2)>  Na2HP04   dibasic sodium phosphate, anhydrous ------ 29.6g
>  KH2P04    monobasic potassium phosphate anhydrous ------- 8.6g
>  NaCl   sodium chloride ------- 144g
>  NaOH - 10 N sodium hydroxide ------- 3.1mL• To volume (4L) with dH2O.TBB for NovaBlot - 3.0g --- Trizma Base
14.4g --- Glycine
200 mL--- MethanolDissolve the above reagents in approx 700mL of dH2O and then bring the solution up to 1L with dH2O.
0
0
Reply
Show more comments (-2) Hide comments
02/01/2017 16:24
  • Overall Experience:
  • Quality:
Product Review: SFTPA2 antibody - N-terminal region (ARP64034_P050) in Human Alveolar, Rat bronchoalveolar lavage, mouse bronchoalveolar lavage and CHO cells using Western blot
Product page for SFTPA2 antibody - N-terminal region (ARP64034_P050)

Researchers: Dr. Joanna Floros and Todd M. Umstead, Pennsylvania State University College of Medicine
Application: Western blotting
Species + Tissue/Cell type: Lane 1: 25ng purified Human Alveolar sample (w/SP-A1+SP-A2) Lane 1: 25ng purified Human Alveolar sample (w/SP-A1+SP-A2)
Lane 2: 20ug Rat bronchoalveolar lavage
Lane 3: 25ng hSP-A2 variant expressed in CHO cells
Lane 4: 25ng hSP-A2 variant expressed in CHO cells
Lane 5: 25ng hSP-A1/A2 variants expressed in CHO cells
Lane 6: 25ng hSP-A1/A2 variants expressed in CHO cells
Lane 7: 20ug SP-A1/2 KO mouse bronchoalveolar lavage
Lane 8: 20ug hSP-A2 variant transgenic mouse bronchoalveolar lavage
Lane 9: 20ug hSP-A2 variant transgenic mouse bronchoalveolar lavage
Lane 10: 20ug hSP-A1 variant transgenic mouse bronchoalveolar lavage
Lane 11: 20ug hSP-A1 variant transgenic mouse bronchoalveolar lavage
Lane 12: 20ug hSP-A1/A2 variants transgenic mouse bronchoalveolar lavage
Lane 13: 20ug mSP-A1/A2 bronchoalveolar lavage; +/- mouse
Lane 14: 20ug mSP-A1/A2 bronchoalveolar lavage; WT mouse
Lane 15: 10ug human alveolar cell lysate
Lane 16: 25ng purified hSP-A1/A2
Primary antibody dilution: 1:2500
Secondary antibody: IgG HRP Conj
Secondary antibody dilution: 1:10000


Questionnaire:
How do Aviva's reagents play a role in your experimental goals? Gives me the ability to detect the amount of SP-A2 in my total SP-A sample…
How would you rate this antibody on a scale from 1-5 (5=best) and why? 5. High sensitivity, low background and little cross reactivity with other proteins including hSP-A1…
Would you use this antibody in future experiments? Yes.
Have you used another antibody which has worked in your application? Yes.
Do you believe the information about the reagent on Aviva's website is correct? Yes.
If the antibody works, do you plan to use it in future experiments or to publish your data? Why or why not? Yes, and I have already purchased a second aliquot of the SFTPA2 antibody to use for Western blots and ELISA…
How did you store the antibody after re-suspension? Aliquoted at -20 degree C.
Sample Description (please include 1) species type, and 2) cell/tissue type, and 3) how much protein loaded for each lane of your gel): Human SP-A samples purified from Human BAL, CHO cell lines, and transgenic mice (25ng/lane), rat and mouse BALs (12.5uL/lane, protein content unknown), and Human Type II cell extracts (10uL/lane, protein content unknown).
How many different experimental trials were conducted using the antibody sample? One.
How was this sample prepared? Samples were lyophilized and resuspended in Laemmli Buffer.
Primary antibody dilution and incubation time: 1:2,500 (0.4ug/mL) for 2hrs
Secondary antibody used and dilution and incubation time: 1:10,000 Bio-Rad GAR IgG HRP Conj for 1hr
What controls were used in your experiment (positive/negative)? Positive controls included Human SP-A samples as well as variants of hSP-A2 (1A0 and 1A1) expressed in CHO cells and transgenic mice. Negative controls included SP-A KO mouse BAL, WT mouse BAL, and variants of hSP-A1 (6A2 and 6A4) expressed in CHO cells and transgenic mice.
Please include your detailed WB Procedure/Protocol here:  1. Run desired One or Two-Dimensional ExcelGel following the 2DGEL.PRO protocol.
2. Transfer gel to Bio-Rad Trans-Blot Transfer Medium (Nitrocellulose, 0.45 um) using NovaBlot apparatus for 90 minutes at 250 mA (Pushed by 12 V).
3. Block for 1 hour with 200 mL 1X PBS, 1% Bovine Serum Albumin (BSA) (or overnight).
4. Rinse 2 times with 100 mL 1X PBS, 0.5 % Tween 20.
5. Wash 1 time for 10 minutes with 200 mL 1X PBS, 0.5 % Tween 20.
6. 1st Ab - 1:2,500 Aviva SFTPA2 Antibody in 100 mL 1 % BSA, 0.05% Tween 20, 1X PBS for 2 hours.
7. Rinse 2 times with 100 mL 1X PBS, 0.5 % Tween 20.
8. Wash 3 times 10 minutes with 200 mL 1X PBS, 0.5 % Tween 20.
9. 2nd Ab - 1:10,000 Bio-Rad GAR IgG HRP (conj) in 100 mL 1 % BSA, 0.05% Tween 20, 1X PBS for 1 hour.
10. Rinse 2 times with 100 mL 1X PBS, 0.5 % Tween 20.
11. Wash 3 times 10 minutes with 200 mL 1X PBS, 0.5 % Tween 20.
12. Rinse 1 time with 200 mL 1X PBS (transport to dark room in this solution).
13. ECL develop for 1 minute with 20 mL of each ECL solution (NEN)(get ECL solutions out ahead of time and allow the 20 mL aliquots of each to warm to room temperature before use).
14. Wrap membrane in Saran Wrap and smooth out any extra solution ® tape into an X-ray cassette.
15. Expose to X-ray film for 15 seconds, 1 minute, 2 minutes and 5 minutes ® develop films and determine if additional exposures are needed ® expose and develop.
Volumes of solutions for the above steps may vary depending on membrane size.
0
0
Reply
Show more comments (-2) Hide comments

2 Item(s)

What kind of abuse are you reporting?
    Please, wait...