Search Antibody, Protein, and ELISA Kit Solutions

SFMBT1 Antibody - middle region (ARP74215_P050)

Click here to learn more about Aviva's By-Request Conjugation Service.
100 ul
In Stock
Request Bulk Order Quote

Conjugation Options

ARP74215_P050-FITC Conjugated

ARP74215_P050-HRP Conjugated

ARP74215_P050-Biotin Conjugated

Click here to learn more about Aviva's By-Request Conjugation Service.
Tested Species Reactivity:
Predicted Species Reactivity:
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Gene Symbol:
Official Gene Full Name:
cm-like with four mbt domains 1
NCBI Gene Id:
Protein Name:
Scm-like with four MBT domains protein 1
Swissprot Id:
Protein Accession #:
Nucleotide Accession #:
Alias Symbols:
Description of Target:
This gene shares high similarity with the Drosophila Scm (sex comb on midleg) gene. It encodes a protein which contains four malignant brain tumor repeat (mbt) domains and may be involved in antigen recognition.
Protein Size (# AA):
Molecular Weight:
95 kDa
Affinity purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express SFMBT1.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express SFMBT1.
The immunogen is a synthetic peptide directed towards the middle region of human SFMBT1
Peptide Sequence:
Synthetic peptide located within the following region: NLFGPRMVLDKCSENCSVLTKTKYTHYYGKKKNKRIGRPPGGHSNLACAL
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
Blocking Peptide:
For anti-SFMBT1 (ARP74215_P050) antibody is Catalog # AAP74215
Printable datasheet for anti-SFMBT1 (ARP74215_P050) antibody

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...