SFMBT1 Antibody - middle region (ARP74215_P050)

Catalog No: ARP74215_P050

Click here to learn more about Aviva's By-Request Conjugation Service.

Host: Rabbit
Target Name: SFMBT1
Sample Tissue: Human HeLa Whole Cell lysates
Antibody Dilution: 1ug/ml

Product Info

• Tested Species Reactivity: Human
• Predicted Species Reactivity: Human
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human SFMBT1
• Purification: Affinity purified
• Peptide Sequence: Synthetic peptide located within the following region: NLFGPRMVLDKCSENCSVLTKTKYTHYYGKKKNKRIGRPPGGHSNLACAL
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-SFMBT1 (ARP74215_P050) antibody is Catalog # AAP74215

Target Info

• Gene Symbol: SFMBT1
• Gene Full Name: cm-like with four mbt domains 1
• Alias Symbols: RU1, SFMBT, hSFMBT
• NCBI Gene Id: 51460
• Protein Name: Scm-like with four MBT domains protein 1
• Description of Target: This gene shares high similarity with the Drosophila Scm (sex comb on midleg) gene. It encodes a protein which contains four malignant brain tumor repeat (mbt) domains and may be involved in antigen recognition.
• Uniprot ID: Q9UHJ3
• Protein Accession #: NP_057413.2
• Nucleotide Accession #: NM_016329.3
• Protein Size (# AA): 866
• Molecular Weight: 95 kDa
• Protein Interactions: ZCCHC10; PHC2; SRPK1; PSMA1; HIST1H4A; HIST1H3A; PHC1; ACP1;