Search Antibody, Protein, and ELISA Kit Solutions

SETD7 Antibody - C-terminal region (ARP48940_T100)

100 ul
$229.00
In Stock
Request Bulk Order Quote

Conjugation Options

ARP48940_T100-FITC Conjugated

ARP48940_T100-HRP Conjugated

ARP48940_T100-Biotin Conjugated

Tested Species Reactivity:
Human
Predicted Species Reactivity:
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat, Zebrafish
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clonality:
Polyclonal
Host:
Rabbit
Application:
WB
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Gene Symbol:
SETD7
Official Gene Full Name:
SET domain containing (lysine methyltransferase) 7
NCBI Gene Id:
80854
Protein Name:
Histone-lysine N-methyltransferase SETD7
Swissprot Id:
Q8WTS6
Protein Accession #:
NP_085151
Nucleotide Accession #:
NM_030648
Alias Symbols:
FLJ21193, KIAA1717, KMT7, SET7, SET7/9, SET9
Replacement Item:
This antibody may replace item sc-28113 from Santa Cruz Biotechnology.
Description of Target:
SETD7 is a histone methyltransferase that specifically monomethylates 'Lys-4' of histone H3. H3 'Lys-4' methylation represents a specific tag for epigenetic transcriptional activation. It plays a central role in the transcriptional activation of genes such as collagenase or insulin. It is recruited by IPF1/PDX-1 to the insulin promoter, leading to activate transcription. It has also methyltransferase activity toward non-histone proteins such as p53/TP53, TAF10, and possibly TAF7 by recognizing and binding the [KR]-[STA]-K in substrate proteins.
Protein Size (# AA):
366
Molecular Weight:
41kDa
Purification:
Protein A purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express SETD7.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express SETD7.
Immunogen:
The immunogen is a synthetic peptide directed towards the C terminal region of human SETD7
Predicted Homology Based on Immunogen Sequence:
Cow: 100%; Dog: 100%; Guinea Pig: 93%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 86%
Complete computational species homology data:
Anti-SETD7 (ARP48940_T100)
Peptide Sequence:
Synthetic peptide located within the following region: PRFGPIKCIRTLRAVEADEELTVAYGYDHSPPGKSGPEAPEWYQVELKAF
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
KLF4; HIST3H3; SOX2; PRKAR1A; A1BG; TP53; NR2F2; STEAP3; SERTAD1; DPY30; MED1; MYOD1; E2F1; HIST1H3A; SMARCA4; H3F3A; STAT3; RELA; AR; UBC; DNMT1; PPP1R12A; SIRT1; TBP; TAF10; TAF7; TAF6; HIST1H4A; ESR1; HIST2H3C; HCFC1; L3MBTL1;
Blocking Peptide:
For anti-SETD7 (ARP48940_T100) antibody is Catalog # AAP48940 (Previous Catalog # AAPP28987)
Datasheets/Manuals:
Printable datasheet for anti-SETD7 (ARP48940_T100) antibody
Target Reference:
Subramanian,K., (2008) Mol. Cell 30 (3), 336-347

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...