SESN1 Antibody - middle region (ARP81624_P050)

Catalog No: ARP81624_P050

Host: Rabbit
Target Name: SESN1
Sample Tissue: Human Mesenchymoma Tumor lysates
Antibody Dilution: 1ug/ml

Product Info

• Tested Species Reactivity: Human
• Predicted Species Reactivity: Human
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human SESN1
• Purification: Affinity purified
• Peptide Sequence: Synthetic peptide located within the following region: KRESMFVFSSDDEEVTPARAVSRHFEDTSYGYKDFSRHGMHVPTFRVQDY
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-SESN1 (ARP81624_P050) antibody is Catalog # AAP81624

Target Info

• Gene Symbol: SESN1
• Gene Full Name: sestrin 1
• Alias Symbols: PA26, SEST1
• NCBI Gene Id: 27244
• Protein Name: sestrin-1
• Description of Target: This gene encodes a member of the sestrin family. Sestrins are induced by the p53 tumor suppressor protein and play a role in the cellular response to DNA damage and oxidative stress. The encoded protein mediates p53 inhibition of cell growth by activating AMP-activated protein kinase, which results in the inhibition of the mammalian target of rapamycin protein. The encoded protein also plays a critical role in antioxidant defense by regenerating overoxidized peroxiredoxins, and the expression of this gene is a potential marker for exposure to radiation. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene.
• Uniprot ID: Q9Y6P5
• Protein Accession #: NP_001186862.1
• Nucleotide Accession #: NM_001199933.1
• Protein Size (# AA): 492
• Molecular Weight: 54 kDa