Size:100 ul
$289.00
In Stock
SKU
ARP47469_P050
Request Bulk
Order Quote
Aviva's
Satisfaction
Guarantee
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email: info@avivasysbio.com
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Conjugation Options

ARP47469_P050-FITC Conjugated

ARP47469_P050-HRP Conjugated

ARP47469_P050-Biotin Conjugated

More Information
Tested Species Reactivity Human, Mouse
Predicted Species Reactivity Cow, Dog, Horse, Human, Mouse, Pig, Rabbit, Rat, Sheep
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clonality Polyclonal
Host Rabbit
Application WB, IHC
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Replacement Item This antibody may replace item sc-158803 from Santa Cruz Biotechnology.
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human SERPINE1
Purification Affinity Purified
Predicted Homology Based on Immunogen Sequence Cow: 100%; Dog: 93%; Horse: 86%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 100%; Sheep: 100%
Complete computational species homology data Anti-SERPINE1 (ARP47469_P050)
Peptide Sequence Synthetic peptide located within the following region: VAHLASDFGVRVFQQVAQASKDRNVVFSPYGVASVLAMLQLTTGGETQQQ
Concentration Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide For anti-SERPINE1 (ARP47469_P050) antibody is Catalog # AAP47469 (Previous Catalog # AAPP27404)
Datasheets/Manuals Printable datasheet for anti-SERPINE1 (ARP47469_P050) antibody
Target Reference Penco,S., (er) BMC Bioinformatics 9 (1), 254 (2008) In press
Gene Symbol SERPINE1
Official Gene Full Name Serpin peptidase inhibitor, clade E (nexin, plasminogen activator inhibitor type 1), member 1
Alias Symbols PAI, PAI-1, PAI1, PLANH1
NCBI Gene Id 5054
Protein Name Plasminogen activator inhibitor 1
Description of Target SERPINE1 acts as 'bait' for tissue plasminogen activator, urokinase, and protein C. Its rapid interaction with TPA may function as a major control point in the regulation of fibrinolysis.
Swissprot Id P05121
Protein Accession # NP_000593
Nucleotide Accession # NM_000602
Protein Size (# AA) 402
Molecular Weight 43kDa
Tissue Tool Find tissues and cell lines supported by DNA array analysis to express SERPINE1.
RNA Seq Find tissues and cell lines supported by RNA-seq analysis to express SERPINE1.
Protein Interactions SGTB; UBQLN1; SGTA; NOS2; UBQLN4; PSMB1; PSMA3; UBC; LRP1B; ACTN4; LRP2; VTN; PLAU; MMP3; F2; PLAT; SERPINE1; PLG; KRT18; KLK2; IGFBP5; ORM1; ELANE; LRP1;
  1. What is the species homology for "SERPINE1 Antibody - N-terminal region (ARP47469_P050)"?

    The tested species reactivity for this item is "Human, Mouse". This antibody is predicted to have homology to "Cow, Dog, Horse, Human, Mouse, Pig, Rabbit, Rat, Sheep".

  2. How long will it take to receive "SERPINE1 Antibody - N-terminal region (ARP47469_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "SERPINE1 Antibody - N-terminal region (ARP47469_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "SERPINE1 Antibody - N-terminal region (ARP47469_P050)"?

    This target may also be called "PAI, PAI-1, PAI1, PLANH1" in publications.

  5. What is the shipping cost for "SERPINE1 Antibody - N-terminal region (ARP47469_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "SERPINE1 Antibody - N-terminal region (ARP47469_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "SERPINE1 Antibody - N-terminal region (ARP47469_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "43kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "SERPINE1 Antibody - N-terminal region (ARP47469_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data tab on the product page.

  10. What are positive controls for "SERPINE1"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "SERPINE1"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "SERPINE1"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "SERPINE1"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "SERPINE1"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "SERPINE1"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:SERPINE1 Antibody - N-terminal region (ARP47469_P050)
Your Rating
We found other products you might like!