Aviva Systems Biology office will be closed for Christmas and New Year Holiday - December 24-25, 2018 and January 1, 2019.
Please go here for more info.

Now Offering Over 102,157 Antibodies & 44,722 Antigens!

SERPINE1 antibody - N-terminal region (ARP47469_P050)

100 ul
$289.00
In Stock

Conjugation Options

ARP47469_P050-FITC Conjugated

ARP47469_P050-HRP Conjugated

ARP47469_P050-Biotin Conjugated

Gene Symbol:
SERPINE1
NCBI Gene Id:
5054
Official Gene Full Name:
Serpin peptidase inhibitor, clade E (nexin, plasminogen activator inhibitor type 1), member 1
Protein Name:
Plasminogen activator inhibitor 1
Swissprot Id:
P05121
Protein Accession #:
NP_000593
Nucleotide Accession #:
NM_000602
Alias Symbols:
PAI, PAI-1, PAI1, PLANH1
Replacement Item:
This antibody may replace item sc-158803 from Santa Cruz Biotechnology.
Description of Target:
SERPINE1 acts as 'bait' for tissue plasminogen activator, urokinase, and protein C. Its rapid interaction with TPA may function as a major control point in the regulation of fibrinolysis.
Protein Size (# AA):
402
Molecular Weight:
43kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity Purified
Application:
WB, IHC
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express SERPINE1.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express SERPINE1.
Immunogen:
The immunogen is a synthetic peptide directed towards the N terminal region of human SERPINE1
Species Reactivity:
Cow, Dog, Horse, Human, Mouse, Pig, Rabbit, Rat, Sheep
Predicted Homology Based on Immunogen Sequence:
Cow: 100%; Dog: 93%; Horse: 86%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 100%; Sheep: 100%
Complete computational species homology data:
Anti-SERPINE1 (ARP47469_P050)
Peptide Sequence:
Synthetic peptide located within the following region: VAHLASDFGVRVFQQVAQASKDRNVVFSPYGVASVLAMLQLTTGGETQQQ
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
SGTB; UBQLN1; SGTA; NOS2; UBQLN4; PSMB1; PSMA3; UBC; LRP1B; ACTN4; LRP2; VTN; PLAU; MMP3; F2; PLAT; SERPINE1; PLG; KRT18; KLK2; IGFBP5; ORM1; ELANE; LRP1;
Blocking Peptide:
For anti-SERPINE1 (ARP47469_P050) antibody is Catalog # AAP47469 (Previous Catalog # AAPP27404)
Datasheets/Manuals:
Printable datasheet for anti-SERPINE1 (ARP47469_P050) antibody
Target Reference:
Penco,S., (er) BMC Bioinformatics 9 (1), 254 (2008) In press

Tell us what you think about this item!

Write A Review
    Please, wait...