Aviva Systems Biology office will be closed for Memorial Day - May 27, 2019.
Please go here for more info.

Search Antibody, Protein, and ELISA Kit Solutions

SERPINE1 Antibody - C-terminal region (ARP47470_P050)

100 ul
In Stock
Request Bulk Order Quote

Conjugation Options

ARP47470_P050-FITC Conjugated

ARP47470_P050-HRP Conjugated

ARP47470_P050-Biotin Conjugated

Gene Symbol:
Official Gene Full Name:
Serpin peptidase inhibitor, clade E (nexin, plasminogen activator inhibitor type 1), member 1
NCBI Gene Id:
Protein Name:
Plasminogen activator inhibitor 1
Swissprot Id:
Protein Accession #:
Nucleotide Accession #:
Alias Symbols:
Replacement Item:
This antibody may replace item sc-158803 from Santa Cruz Biotechnology.
Description of Target:
SERPINE1 acts as 'bait' for tissue plasminogen activator, urokinase, and protein C. Its rapid interaction with TPA may function as a major control point in the regulation of fibrinolysis.
Protein Size (# AA):
Molecular Weight:
Affinity Purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express SERPINE1.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express SERPINE1.
The immunogen is a synthetic peptide directed towards the C terminal region of human SERPINE1
Predicted Species Reactivity:
Cow, Dog, Goat, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat, Sheep, Zebrafish
Tested Species Reactivity:
Predicted Homology Based on Immunogen Sequence:
Cow: 100%; Dog: 100%; Goat: 85%; Guinea Pig: 86%; Horse: 100%; Human: 100%; Mouse: 86%; Pig: 100%; Rabbit: 100%; Rat: 100%; Sheep: 100%; Zebrafish: 83%
Complete computational species homology data:
Anti-SERPINE1 (ARP47470_P050)
Peptide Sequence:
Synthetic peptide located within the following region: VNESGTVASSSTAVIVSARMAPEEIIMDRPFLFVVRHNPTGTVLFMGQVM
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
Blocking Peptide:
For anti-SERPINE1 (ARP47470_P050) antibody is Catalog # AAP47470 (Previous Catalog # AAPP27405)
Printable datasheet for anti-SERPINE1 (ARP47470_P050) antibody
Target Reference:
Penco,S., (er) BMC Bioinformatics 9 (1), 254 (2008) In press

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...