Size:100 ul
Special Price $229.00 Regular Price $289.00
In stock
Request Bulk
Order Quote
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email:
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Conjugation Options

ARP47470_P050-FITC Conjugated

ARP47470_P050-HRP Conjugated

ARP47470_P050-Biotin Conjugated

SERPINE1 Antibody - C-terminal region (ARP47470_P050)

Catalog#: ARP47470_P050
Domestic: within 1-2 days delivery International: 1-2 days
More Information
Tested Species Reactivity Human
Predicted Species Reactivity Cow, Dog, Goat, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat, Sheep, Zebrafish
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clonality Polyclonal
Host Rabbit
Application WB
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Replacement Item This antibody may replace item sc-158803 from Santa Cruz Biotechnology.
Immunogen The immunogen is a synthetic peptide directed towards the C terminal region of human SERPINE1
Purification Affinity Purified
Predicted Homology Based on Immunogen Sequence Cow: 100%; Dog: 100%; Goat: 85%; Guinea Pig: 86%; Horse: 100%; Human: 100%; Mouse: 86%; Pig: 100%; Rabbit: 100%; Rat: 100%; Sheep: 100%; Zebrafish: 83%
Complete computational species homology data Anti-SERPINE1 (ARP47470_P050)
Peptide Sequence Synthetic peptide located within the following region: VNESGTVASSSTAVIVSARMAPEEIIMDRPFLFVVRHNPTGTVLFMGQVM
Concentration Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide For anti-SERPINE1 (ARP47470_P050) antibody is Catalog # AAP47470 (Previous Catalog # AAPP27405)
Datasheets/Manuals Printable datasheet for anti-SERPINE1 (ARP47470_P050) antibody
Target Reference Penco,S., (er) BMC Bioinformatics 9 (1), 254 (2008) In press
Gene Symbol SERPINE1
Official Gene Full Name Serpin peptidase inhibitor, clade E (nexin, plasminogen activator inhibitor type 1), member 1
Alias Symbols PAI, PAI-1, PAI1, PLANH1
NCBI Gene Id 5054
Protein Name Plasminogen activator inhibitor 1
Description of Target SERPINE1 acts as 'bait' for tissue plasminogen activator, urokinase, and protein C. Its rapid interaction with TPA may function as a major control point in the regulation of fibrinolysis.
Swissprot Id P05121
Protein Accession # NP_000593
Nucleotide Accession # NM_000602
Protein Size (# AA) 402
Molecular Weight 43kDa
Tissue Tool Find tissues and cell lines supported by DNA array analysis to express SERPINE1.
RNA Seq Find tissues and cell lines supported by RNA-seq analysis to express SERPINE1.
Write Your Own Review
You're reviewing:SERPINE1 Antibody - C-terminal region (ARP47470_P050)
Your Rating