Size:100 ul
$289.00
In Stock
SKU
ARP72852_P050-FITC
Request Bulk
Order Quote
Aviva's
Satisfaction
Guarantee
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email: info@avivasysbio.com
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Conjugation Options

ARP72852_P050 Unconjugated

ARP72852_P050-HRP Conjugated

ARP72852_P050-Biotin Conjugated

SERPINB9 Antibody - middle region : FITC (ARP72852_P050-FITC)

Catalog#: ARP72852_P050-FITC
Domestic: within 1-2 days delivery | International: 1-2 days
More Information
Predicted Species ReactivityGuinea Pig, Human, Rat
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer.
ClonalityPolyclonal
HostRabbit
ConjugationFITC (FAM): Excitation 495 nm/ Emission 520 nm
ApplicationWB
Reconstitution and StorageAll conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
Replacement ItemThis antibody may replace item sc-122560 from Santa Cruz Biotechnology.
ImmunogenThe immunogen is a synthetic peptide directed towards the middle region of Human SERPINB9
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceGuinea Pig: 77%; Human: 100%; Rat: 77%
Peptide SequenceSynthetic peptide located within the following region: NTWVSKKTEGKIEELLPGSSIDAETRLVLVNAIYFKGKWNEPFDETYTRE
Concentration0.5 mg/ml
Blocking PeptideFor anti-SERPINB9 (ARP72852_P050-FITC) antibody is Catalog # AAP72852
Datasheets/ManualsPrintable datasheet for anti-SERPINB9 (ARP72852_P050-FITC) antibody
Gene SymbolSERPINB9
Alias SymbolsSERPINB9, PI9,
NCBI Gene Id5272
Description of TargetThis gene encodes a member of the serine protease inhibitor family which are also known as serpins. The encoded protein belongs to a subfamily of intracellular serpins. This protein inhibits the activity of the effector molecule granzyme B. Overexpression of this protein may prevent cytotoxic T-lymphocytes from eliminating certain tumor cells. A pseudogene of this gene is found on chromosome 6.
Swissprot IdP50453
Protein Accession #XP_005249241
Protein Size (# AA)376
Molecular Weight41kDa
Tissue ToolFind tissues and cell lines supported by DNA array analysis to express SERPINB9.
RNA SeqFind tissues and cell lines supported by RNA-seq analysis to express SERPINB9.
Protein InteractionsTRAF5; CD81; IGSF8; CDK2; UBC; LRIF1; COPS6; MED31; CCDC90B; RBM48; BRD7; PLEKHM1; IGSF21; PRPF40A; ZHX1; UBR1; SETDB1; C14orf1; UNC119; CASP4; CRMP1; GDF9; ECH1; GBP2; TLE1; TP53; XRCC6; GAPDH; EEF1A1; GZMB; TUBB2A;
Write Your Own Review
You're reviewing:SERPINB9 Antibody - middle region : FITC (ARP72852_P050-FITC)
Your Rating
Aviva Live Chat
Aviva HIS tag Deal
Aviva Tissue Tool
Aviva ChIP Antibodies