SERPINB6 Antibody - middle region (ARP59249_P050)

Catalog No: ARP59249_P050

WB Suggested Anti-SERPINB6 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: Human Placenta

Product Info

• Tested Species Reactivity: Human
• Predicted Species Reactivity: Human, Cow
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human SERPINB6
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Cow: 79%; Human: 100%
• Peptide Sequence: Synthetic peptide located within the following region: LVLVNAVYFRGNWDEQFDKENTEERLFKVSKNEEKPVQMMFKQSTFKKTY
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-SERPINB6 (ARP59249_P050) antibody is Catalog # AAP59249 (Previous Catalog # AAPP45238)

Target Info

• Gene Symbol: SERPINB6
• Gene Full Name: Serpin peptidase inhibitor, clade B (ovalbumin), member 6
• Alias Symbols: CAP, PI6, PTI, PI-6, SPI3, DFNB91, MSTP057
• NCBI Gene Id: 5269
• Protein Name: Serpin B6
• Description of Target: The protein encoded by this gene is a member of the serpin (serine proteinase inhibitor) superfamily, and ovalbumin(ov)-serpin subfamily. It was originally discovered as a placental thrombin inhibitor. The mouse homolog was found to be expressed in the hair cells of the inner ear. Mutations in this gene are associated with nonsyndromic progressive hearing loss, suggesting that this serpin plays an important role in the inner ear in the protection against leakage of lysosomal content during stress, and that loss of this protection results in cell death and sensorineural hearing loss. Alternatively spliced transcript variants have been found for this gene.
• Uniprot ID: P35237
• Protein Accession #: NP_004559
• Nucleotide Accession #: NM_004568
• Protein Size (# AA): 376
• Molecular Weight: 41kDa
• Protein Interactions: SUMO2; C16orf70; AHCY; CRK; UBC; F10; PLAU; F2; PROC; PLG; KLK2;