- Toll Free: 888-880-0001
- Phone: 858-552-6979
- Email: info@avivasysbio.com
- $55: Antibody & Protein in US
- $55 + $25/Kit in US
- Contact us for international orders.
| Datasheets/Manuals | Printable datasheet for SERPINB3/4 Antibody (OAAF08169) |
|---|
| Predicted Species Reactivity | Human|Mouse|Rat |
|---|---|
| Product Format | Liquid. PBS (without Mg2+ and Ca2+), pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol. |
| Clonality | Polyclonal |
| Host | Rabbit |
| Application | Enzyme-linked immunosorbent assay|Immunofluorescence|Immunohistochemistry-Paraffin|Western blot |
| Reconstitution and Storage | -20°C |
| Immunogen | The antiserum was produced against synthesized peptide derived from the Internal region of human SERPINB3/4. |
| Purification | The antibody was affinity-purified from rabbit antiserum by affinity-chromatography using peptide. |
| Peptide Sequence | Synthetic peptide located within the following region: KTYLFLQEYLDAIKKFYQTSVESVDFANAPEESRKKINSWVESQTNEKIK |
| Concentration | 1mg/ml |
| Specificity | SERPINB3/4 Antibody detects endogenous levels of SERPINB3/4 protein. |
| Application Info | WB: 1:500~1000 ELISA: 1:10000 |
| Gene Symbol | SERPINB3|SERPINB4 |
|---|---|
| Gene Full Name | serpin family B member 3|serpin family B member 4 |
| Alias Symbols | HsT1196;LEUPIN;peptidase inhibitor 11;PI11;protease inhibitor (leucine-serpin);protein T4-A;SCC;SCCA1;SCCA-1;SCCA2;SCCA-2;SCCA2/SCCA1 fusion protein;SCCA-PD;serine (or cysteine) proteinase inhibitor, clade B (ovalbumin), member 3;serine (or cysteine) proteinase inhibitor, clade B (ovalbumin), member 4;serpin B3;serpin B4;serpin peptidase inhibitor, clade B (ovalbumin), member 3;serpin peptidase inhibitor, clade B (ovalbumin), member 4;squamous cell carcinoma antigen 1;squamous cell carcinoma antigen 2;SSCA1;T4-A. |
| NCBI Gene Id | 6317|6318 |
| Protein Name | Serpin B3|Serpin B4 |
| Description of Target | May act as a papain-like cysteine protease inhibitor to modulate the host immune response against tumor cells. Also functions as an inhibitor of UV-induced apoptosis via suppression of the activity of c-Jun NH(2)-terminal kinase (JNK1).|May act as a protease inhibitor to modulate the host immune response against tumor cells. |
| Uniprot ID | P29508|P48594 |
| Molecular Weight | 44 kDa |
- Protocol:
- Reconstitution & Storage Instructions
- Western Blotting/Immunoblotting (WB/IB) Protocol
- Immunohistochemistry (IHC) Protocol
- Immunocytochemistry (ICC) Protocol
- Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol
- Blocking Peptide Competition Protocol (BPCP)
- Immunoprecipitation (IP) Protocol
- Antibody Array (AA) Protocol
- Tips Information:
-
See our General FAQ page.
-
What is the species homology for "SERPINB3/4 Antibody (OAAF08169)"?
The tested species reactivity for this item is "". This antibody is predicted to have homology to "Human|Mouse|Rat".
-
How long will it take to receive "SERPINB3/4 Antibody (OAAF08169)"?
This item is available "Domestic: within 1-2 week delivery | International: 1-2 weeks".
-
What buffer format is "SERPINB3/4 Antibody (OAAF08169)" provided in?
This item is provided in "Liquid. PBS (without Mg2+ and Ca2+), pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol.".
Additional format options may be available. For more information please contact info@avivasysbio.com. -
What are other names for "SERPINB3/4 Antibody (OAAF08169)"?
This target may also be called "HsT1196;LEUPIN;peptidase inhibitor 11;PI11;protease inhibitor (leucine-serpin);protein T4-A;SCC;SCCA1;SCCA-1;SCCA2;SCCA-2;SCCA2/SCCA1 fusion protein;SCCA-PD;serine (or cysteine) proteinase inhibitor, clade B (ovalbumin), member 3;serine (or cysteine) proteinase inhibitor, clade B (ovalbumin), member 4;serpin B3;serpin B4;serpin peptidase inhibitor, clade B (ovalbumin), member 3;serpin peptidase inhibitor, clade B (ovalbumin), member 4;squamous cell carcinoma antigen 1;squamous cell carcinoma antigen 2;SSCA1;T4-A." in publications.
-
What is the shipping cost for "SERPINB3/4 Antibody (OAAF08169)"?
The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.
-
What is the guarantee for "SERPINB3/4 Antibody (OAAF08169)"?
All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.
-
Can I get bulk pricing for "SERPINB3/4 Antibody (OAAF08169)"?
You can get bulk pricing for this item by going here.
-
What is the molecular weight of the protein?
The molecular weight reported by Uniprot for this item is "44 kDa".
Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics. -
What protocols are available for "SERPINB3/4 Antibody (OAAF08169)"?
We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.
-
What are positive controls for "SERPINB3|SERPINB4"?
We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.
-
What are negative controls for "SERPINB3|SERPINB4"?
We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.
-
What other proteins interact with "SERPINB3|SERPINB4"?
This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.
-
What biological processes are associated with "SERPINB3|SERPINB4"?
This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.
-
What cellular components are associated with "SERPINB3|SERPINB4"?
This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.
-
What protein functions are associated with "SERPINB3|SERPINB4"?
This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.
